ZNF775 PrEST Antigen

ZNF775 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST96140.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen ZNF775, Gene description: zinc finger protein 775, Alternative Gene Names:... more
Product information "ZNF775 PrEST Antigen"
PrEST Antigen ZNF775, Gene description: zinc finger protein 775, Alternative Gene Names: MGC33584, Antigen sequence: GTGAGLVMKVKQEKPERLLQTLAPQAMLVEKDKENIFQQHRGLPPRQTMGRPRALGGQEESGSPRWAPPTEQDAGLAGRAPGSASGPLSPSLSSG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] Mouse gene identity: 71% Rat gene identity: 71%
Keywords: ZNF775, Zinc finger protein 775
Supplier: Atlas Antibodies
Supplier-Nr: APrEST96140

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Database Information

UniProt ID : Q96BV0 | Matching products
Gene ID : GeneID 285971 | Matching products

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "ZNF775 PrEST Antigen"
Write a review
or to review a product.
Viewed