Products from Atlas Antibodies
Atlas Antibodies AB from Stockholm (Sweden) aims to make the unique antibodies used in the Human Protein Atlas project available to all interested researchers. Based on the idea to create a complete map of human protein expression and localization, the project developed its own set of highly specific antibodies that met the quality demands of such an ambitious project. These unique antibodies were made commercially available in 2006 by Atlas Antibodies as Triple A (Atlas Antibodies Advanced) Polyclonals. Since then, Atlas Antibodies has also introduced PrecisA Monoclonals (the swedish word "precisa" stands for precise, accurate and targeted) and PrEST Antigens (recombinant human Protein Epitope Signature Tags). All of these products are based on the same high-quality manufacturing principles.
More information at: www.atlasantibodies.com
No results were found for the filter!
PRUNE2 PrEST Antigen
Item number: ATA-APrEST96130.100
PrEST Antigen PRUNE2, Gene description: prune homolog 2 with BCH domain, Alternative Gene Names: A214N16.3, bA214N16.3, BMCC1, BNIPXL, C9orf65, KIAA0367, Antigen sequence: AFDHSFSDASGLNTSTGTIDDMSKLTLSEGHPETPVDGDLGKQDICSSEASWGDFEYDVMGQNIDEDLLREPEHFLYGGDPPLEEDSLKQSLAPYTPPFDLSYLTEPAQSAETIEEAGSPEDESLGCRAAEIVLSALPDR,...
| Keywords: | BMCC1, PRUNE2, Protein prune homolog 2, BNIP2 motif-containing molecule at the C-terminal region 1 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
GPC6 PrEST Antigen
Item number: ATA-APrEST96131.100
PrEST Antigen GPC6, Gene description: glypican 6, Antigen sequence: AYNGNDVNFQDTSDESSGSGSGSGCMDDVCPTEFEFVTTEAPAVDPDRREVDSSAAQRGHSLLSWSLTCIVLAL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Cell surface proteoglycan that bears heparan sulfate. Putative cell surface...
| Keywords: | GPC6 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
IFT27 PrEST Antigen
Item number: ATA-APrEST96144.100
PrEST Antigen IFT27, Gene description: intraflagellar transport 27, Alternative Gene Names: BBS19, FAP156, RABL4, RAYL, Antigen sequence: MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKELFSEMLDKLWESPNVLCLVYDV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Keywords: | RABL4, IFT27, Rab-like protein 4, Putative GTP-binding protein RAY-like, Intraflagellar transport protein 27 homolog |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
CCDC83 PrEST Antigen
Item number: ATA-APrEST96147.100
PrEST Antigen CCDC83, Gene description: coiled-coil domain containing 83, Alternative Gene Names: CT148, FLJ42119, KP-CoT-23, MGC34732, Antigen sequence: AKLITSLQNDINTVKENAEKMSEHYKITLEDTRKKIIKETLLQLDQKKEWATQNAVKLIDKGSYLEIWENDWLKKEVAIHRKEVEEL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles....
| Keywords: | HSD9, CCDC83, Coiled-coil domain-containing protein 83 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
GP6 PrEST Antigen
Item number: ATA-APrEST96149.100
PrEST Antigen GP6, Gene description: glycoprotein VI platelet, Alternative Gene Names: GPVI, Antigen sequence: ADPEIKRGSGWRPTGCSQPRVMFMTAEPQARSYPREGSWHGRRLKDWRVWSVEAGGQRLQLWKRGHAASSWCSIREPFGQCLSVCLP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Collagen receptor...
| Keywords: | GPVI, Glycoprotein 6, Platelet glycoprotein VI |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
ESX1 PrEST Antigen
Item number: ATA-APrEST96154.100
PrEST Antigen ESX1, Gene description: ESX homeobox 1, Alternative Gene Names: ESX1L, ESXR1, Antigen sequence: MESLRGYTHSDIGYRSLAVGEDIEEVNDEKLTVTSLMARGGEDEENTRSKPEYGTEAENNVGTEGSVPSDDQDR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May coordinately regulate cell cycle...
| Keywords: | ESX1, ESX1L |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
FAM228A PrEST Antigen
Item number: ATA-APrEST96157.100
PrEST Antigen FAM228A, Gene description: family with sequence similarity 228 member A, Alternative Gene Names: C2orf84, FLJ30851, Antigen sequence: FTFTSHCVIPKEWHKASARARSKTYKYSPEKLIYADKKQKRKEKKTADLSQAAFERQFLSSKLSQKNKVGERKGLVSRGLGRGWHAGLCSTHE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles....
| Keywords: | FAM228A, C2orf84, Protein FAM228A |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
MAPK9 PrEST Antigen
Item number: ATA-APrEST96159.100
PrEST Antigen MAPK9, Gene description: mitogen-activated protein kinase 9, Alternative Gene Names: JNK2, p54a, PRKM9, SAPK, Antigen sequence: KDQPSDAAVSSNATPSQSSS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Serine/threonine-protein kinase involved in various processes...
| Keywords: | JNK2, MAPK9, JNK-55, MAPK 9, SAPK1a, MAP kinase 9, c-Jun N-terminal kinase 2, Mitogen-activated protein kinase 9,... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
SLC20A1 PrEST Antigen
Item number: ATA-APrEST96161.100
PrEST Antigen SLC20A1, Gene description: solute carrier family 20 member 1, Alternative Gene Names: Glvr-1, GLVR1, PiT-1, PiT1, Antigen sequence: YTSYCNAVSDLHSASEIDMSVKAEMGLGDRKGSNGSLEEWYDQDKPEVS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Sodium-phosphate symporter...
| Keywords: | GLVR1, PiT-1, GLVR-1, SLC20A1, Phosphate transporter 1, Solute carrier family 20 member 1, Leukemia virus receptor 1... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
JUN PrEST Antigen
Item number: ATA-APrEST96167.100
PrEST Antigen JUN, Gene description: Jun proto-oncogene, AP-1 transcription factor subunit, Alternative Gene Names: AP-1, c-Jun, Antigen sequence: PTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Keywords: | AP1, p39, JUN, Activator protein 1, Proto-oncogene c-Jun, Transcription factor AP-1, V-jun avian sarcoma virus 17 oncogene... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
RFX5 PrEST Antigen
Item number: ATA-APrEST96170.100
PrEST Antigen RFX5, Gene description: regulatory factor X5, Antigen sequence: TVSKGGRGPGSQHTKEAEDKIPLVPSKVSVIKGSRSQKEAFPLAKGEVDTAPQGNKDLKEHVLQSSLSQEHKDP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Activates transcription from class II MHC promoters. Recognizes...
| Keywords: | RFX5, Regulatory factor X 5, DNA-binding protein RFX5 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
COL1A2 PrEST Antigen
Item number: ATA-APrEST96171.100
PrEST Antigen COL1A2, Gene description: collagen type I alpha 2 chain, Alternative Gene Names: OI4, Antigen sequence: GPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Type I collagen is a member of group I collagen (fibrillar forming...
| Keywords: | COL1A2, Alpha-2 type I collagen, Collagen alpha-2(I) chain |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*