- Search results for U3KNX2
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
8 products were found matching "U3KNX2"!
Close filters
Filter by:
No results were found for the filter!
Item number: DIY2579U-003
The Rabbit CXCL9 (MIG) ELISA contains capture antibody, standard, and detection antibody for development of a Rabbit CXCL9 ELISA. The antibodies have been determined to function in an ELISA with the standard provided. Optimal buffers, concentrations, incubation times, incubation temperatures, and methods for the...
| Keywords: | CXCL9, C-X-C motif chemokine |
| Application: | ELISA |
| Species reactivity: | rabbit |
From 1,098.00€
*
Item number: RP2576U-005
The Rabbit CXCL9 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit CXCL9 applications are for cell culture, ELISA standard, and Western Blot Control. Rabbit CXCL9 yeast-derived recombinant protein can be...
| Keywords: | CXCL9, C-X-C motif chemokine |
| Application: | Bioassays |
| Expressed in: | Yeast |
| Origin: | rabbit |
| MW: | 11.6 kD |
From 233.00€
*
Item number: KPB1306U-050
| Keywords: | Anti-C-X-C motif chemokine |
| Application: | ELISA |
| Host: | Chicken |
| Species reactivity: | rabbit |
549.00€
*
Item number: CSB-EP006252RB.1
Organism: Oryctolagus cuniculus (Rabbit). Source: E.coli. Expression Region: 23-124aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: SPIMRNGRCS CISSTQGKIH LQSLKDLKQF SPSPSCGKTE IIATKKDGTQ ICLNPDSTEV KELVEKWKKQ SSPKKKQKKG KKQRKVKKSL KKSQRPHQKK TA....
| Keywords: | C-X-C motif chemokine, Recombinant Rabbit C-X-C motif chemokine (CXCL9) |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | rabbit |
| MW: | 27.5 kD |
From 364.00€
*
Item number: 372938.100
Source:, Recombinant protein corresponding to aa23-124 from rabbit CXCL9, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.5kD, AA Sequence: SPIMRNGRCSCISSTQGKIHLQSLKDLKQFSPSPSCGKTEIIATKKDGTQICLNPDSTEVKELVEKWKKQSSPKKKQKKGKKQRKVKKSLKKSQRPHQKKTA, Storage and Stability: May be stored at...
| Keywords: | C-X-C motif chemokine |
| MW: | 27,5 |
From 786.00€
*
Item number: KP1305U-020
| Keywords: | Anti-C-X-C motif chemokine |
| Application: | WB, ELISA |
| Host: | Chicken |
| Species reactivity: | rabbit |
From 274.00€
*
Item number: SPOT2507U-004
Rabbit CXCL9 ELISpot contains Capture Antibody, Standard Control, and Detection Antibody for development of up to two (2) ELISpot assays. Other required materials and reagents are not supplied. The antibodies have been determined to function in an ELISpot with the Standard Control provided. Components may also be...
| Keywords: | C-X-C motif chemokine |
| Application: | ELISpot |
| Species reactivity: | rabbit |
1,646.00€
*
Item number: CSB-PA006252ZA01RB.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-C-X-C motif chemokine, CXCL9 Antibody |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Oryctolagus cuniculus (Rabbit) |
From 1,529.00€
*