14 products were found matching "Q9Z1R3"!
No results were found for the filter!
Apolipoprotein M/APOM Protein, Mouse, Recombinant (His)
Item number: TGM-TMPH-02518-10ug
Description: Probably involved in lipid transport. Can bind sphingosine-1-phosphate, myristic acid, palmitic acid and stearic acid, retinol, all-trans-retinoic acid and 9-cis-retinoic acid. APOM Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 23.3 kDa and...
| Keywords: | Ng20 , Apom , ApoM , Apo-M , Apolipoprotein M |
| MW: | 23.3 kD |
From 99.00€
*
Apolipoprotein M/APOM Protein, Mouse, Recombinant (E....
Item number: TGM-TMPH-04505-100ug
Description: Apolipoprotein M/APOM Protein, Mouse, Recombinant (E. coli, His) is expressed in E. coli. The accession number is Q9Z1R3.
| Keywords: | Apom , Apo-M,ApoM , Ng20 , Apolipoprotein M |
| MW: | 27.2 kD |
From 93.00€
*
Anti-Apolipoprotein M, Internal
Item number: ARG64714.100
Protein function: Probably involved in lipid transport. Can bind sphingosine-1-phosphate, myristic acid, palmitic acid and stearic acid, retinol, all-trans-retinoic acid and 9-cis-retinoic acid. [The UniProt Consortium]
| Keywords: | Anti-Apom, Anti-Ng20, Anti-ApoM, Anti-Apo-M, Anti-Apolipoprotein M |
| Application: | ELISA, WB |
| Host: | Goat |
| Species reactivity: | human |
871.00€
*
Anti-Apom
Item number: NSJ-R34449-100UG
0.5 mg/ml in 1X TBS, pH7.3, with 0.5% BSA (US sourced) and 0.02% sodium azide. Additional name(s) for this target protein: Apolipoprotein M Protein function: Probably involved in lipid transport. Can bind sphingosine-1-phosphate, myristic acid, palmitic acid and stearic acid, retinol, all-trans-retinoic acid and...
| Keywords: | Anti-Ng20, Anti-ApoM, Anti-Apom, Anti-Apo-M, Anti-Apolipoprotein M, Apom Antibody |
| Application: | WB, ELISA (peptide) |
| Host: | Goat |
| Species reactivity: | human |
836.00€
*
Mouse ApoM (Apolipoprotein M) ELISA Kit
Item number: G-MOES01281.96
ELISA Type: Sandwich. Sensitivity: 0.094ng/mL. Range: 0.156--10ng/mL. Protein function: Probably involved in lipid transport. Can bind sphingosine-1- phosphate, myristic acid, palmitic acid and stearic acid, retinol, all- trans-retinoic acid and 9-cis-retinoic acid. [The UniProt Consortium]
| Keywords: | Ng20, Apom, ApoM, Apo-M, Apolipoprotein M |
| Application: | Sandwich ELISA |
| Species reactivity: | mouse |
708.00€
*
Apolipoprotein M (Apom), mouse, recombinant
Item number: CSB-EP001947MO.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 1-190aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: MFHQVWAALL SLYGLLFNSM NQCPEHSQLT ALGMDDTETP EPHLGLWYFI AGAASTTEEL ATFDPVDNIV FNMAAGSAPR QLQLRATIRT KSGVCVPRKW TYRLTEGKGN MELRTEGRPD MKTDLFSSSC...
| Keywords: | ApoM, Ng20, Apom, Apo-M, Apolipoprotein M, Recombinant Mouse Apolipoprotein M (Apom) |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | mouse |
| MW: | 27.2 kD |
From 247.00€
*
Apolipoprotein M (Apom), mouse, recombinant
Item number: CSB-YP001947MO.1
Organism: Mus musculus (Mouse). Source: Yeast. Expression Region: 1-190aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: MFHQVWAALL SLYGLLFNSM NQCPEHSQLT ALGMDDTETP EPHLGLWYFI AGAASTTEEL ATFDPVDNIV FNMAAGSAPR QLQLRATIRT KSGVCVPRKW TYRLTEGKGN MELRTEGRPD MKTDLFSSSC PGGIMLKETG...
| Keywords: | ApoM, Ng20, Apom, Apo-M, Apolipoprotein M, Recombinant Mouse Apolipoprotein M (Apom) |
| Application: | Activity not tested |
| Expressed in: | Yeast |
| Origin: | mouse |
| MW: | 23.3 kD |
From 292.00€
*
APOM Protein, Mouse, Recombinant (His)
Item number: TGM-TMPH-02518-100ug
Description: Probably involved in lipid transport. Can bind sphingosine-1-phosphate, myristic acid, palmitic acid and stearic acid, retinol, all-trans-retinoic acid and 9-cis-retinoic acid. APOM Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 23.3 kDa and...
| Keywords: | ApoM, Apo-M, Apolipoprotein M, Ng20 |
| MW: | 23.3 kD |
From 266.00€
*
Mouse APOM (Apolipoprotein M) ELISA Kit
Item number: G-AEKE05418.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse APOM. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse APOM. Next,...
| Keywords: | Apom, Apolipoprotein M |
| Application: | ELISA |
| Species reactivity: | rat |
694.00€
*
Mouse Apolipoprotein M (APOM) ELISA kit
Item number: CSB-EL001947MO.48
Sample Types: serum, plasma, tissue homogenates Detection Range: 1.56 ng/mL-100 ng/mL Sensitivity: 0.39 ng/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: Probably involved in lipid transport. Can bind sphingosine-1-...
| Keywords: | Ng20, Apom, ApoM, Apo-M, Apolipoprotein M |
| Application: | ELISA, Sandwich ELISA |
| Species reactivity: | mouse |
From 581.00€
*
Anti-Apolipoprotein M (ApoM, G3a, HSPC336, MGC22400,...
Item number: A2299-42F.100
Apolipoprotein M (ApoM) is a member of the lipocalin protein family. It is found associated with high density lipoproteins and to a lesser extent with low density lipoproteins and triglyceride-rich lipoproteins. It is positively related to leptin. It is mainly expressed in liver and kidney. ApoM is secreted through...
| Keywords: | Anti-Apo-M |
| Application: | ELISA, WB |
| Host: | Goat |
| Species reactivity: | human |
797.00€
*
Apolipoprotein M (APOM) Recombinant, Mouse
Item number: 153589.10
Source:, Recombinant Mouse from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q9Z1R3, Fragment: Met20~Lys190 (Accession No: Q9Z1R3), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGS-M NQCPEHSQLT ALGMDDTETP EPHLGLWYFI AGAASTTEEL ATFDPVDNIV FNMAAGSAPR...
From 454.00€
*