12 products were found matching "Q9Y6Q5"!
No results were found for the filter!
Anti-AP1M2
Item number: ARG41196.100
Protein function: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo...
| Keywords: | Anti-AP1M2, Anti-Mu1B-adaptin, Anti-Mu-adaptin 2, Anti-AP-1 complex subunit mu-2, Anti-AP-mu chain family member mu1B,... |
| Application: | IHC (paraffin), WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
707.00€
*
Anti-AP1M2
Item number: ATA-HPA054999.100
Protein function: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo...
| Keywords: | Anti-AP1M2, Anti-Mu1B-adaptin, Anti-Mu-adaptin 2, Anti-AP-1 complex subunit mu-2, Anti-AP-mu chain family member mu1B,... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Anti-AP1M2
Item number: ATA-HPA077258.100
Polyclonal Antibody against Human AP1M2, Gene description: adaptor related protein complex 1 subunit mu 2, Alternative Gene Names: AP1-mu2, HSMU1B, mu2, Validated applications: ICC, WB, Uniprot ID: Q9Y6Q5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Keywords: | Anti-AP1M2, Anti-Mu1B-adaptin, Anti-Mu-adaptin 2, Anti-AP-1 complex subunit mu-2, Anti-AP-mu chain family member mu1B,... |
| Application: | WB, ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
AP1M2 (human), recombinant protein
Item number: ABS-PP-6598-L.100
Protein function: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo...
| Keywords: | AP-1 complex subunit mu-2, AP-mu chain family member mu1B, Adaptor protein complex AP-1 subunit mu-2, Adaptor-related... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 16.5 kD |
From 115.00€
*
AP1M2, Human adaptor-related protein complex 1, mu 2...
Item number: VHPS-413
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | AP1M2, Mu-adaptin 2, Mu1B-adaptin, AP-1 complex subunit mu-2, AP-mu chain family member mu1B, Adaptor protein complex AP-1... |
| Application: | RNA quantification |
45.00€
*
AP1M2 PrEST Antigen
Item number: ATA-APrEST91602.100
Protein function: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo...
| Keywords: | AP1M2, Mu1B-adaptin, Mu-adaptin 2, AP-1 complex subunit mu-2, AP-mu chain family member mu1B, Adaptor protein complex AP-1... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Anti-AP1M2
Item number: ELK-ES18311.100
This gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 1 (AP-1), which belongs to the adaptor complexes medium subunits family. This protein is capable of interacting with tyrosine-based sorting signals. Alternative splicing results in multiple transcript variants. [provided by RefSeq,...
| Keywords: | Anti-AP1M2, Anti-Mu1B-adaptin, Anti-Mu-adaptin 2, Anti-AP-1 complex subunit mu-2, Anti-AP-mu chain family member mu1B,... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 173.00€
*
Human AP1M2 (AP-1 complex subunit mu-2) ELISA Kit
Item number: G-AEFI00330.96
ELISA Type: Sandwich ELISA, Double Antibody. Detection Range: 15.625-1000µg/mL. Sensitivity: 9.375µg/mL. Sample Types: Serum, Plasma, Cell Culture Supernatant, cell or tissue lysate, Other liquid samples. Protein function: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting...
| Keywords: | AP1M2, Mu1B-adaptin, Mu-adaptin 2, AP-1 complex subunit mu-2, AP-mu chain family member mu1B, Adaptor protein complex AP-1... |
| Application: | Sandwich ELISA, Double Antibody |
| Species reactivity: | human |
698.00€
*
Anti-AP1M2
Item number: CSB-PA001865GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: AP1M2. Antigen Species: Human
| Keywords: | Anti-AP1M2, Anti-Mu1B-adaptin, Anti-Mu-adaptin 2, Anti-AP-1 complex subunit mu-2, Anti-AP-mu chain family member mu1B,... |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
552.00€
*
Anti-AP1M2
Item number: CSB-PA895771ESR1HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: AP1M2. Antigen Species: Human
| Keywords: | Anti-AP1M2, Anti-Mu1B-adaptin, Anti-Mu-adaptin 2, Anti-AP-1 complex subunit mu-2, Anti-AP-mu chain family member mu1B,... |
| Application: | ELISA, WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 167.00€
*
AP1M2 (human), recombinant protein
Item number: ABS-PP-6598.100
Protein function: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo...
| Keywords: | AP-1 complex subunit mu-2, AP-mu chain family member mu1B, Adaptor protein complex AP-1 subunit mu-2, Adaptor-related... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 16.5 kD |
From 90.00€
*
AP1M2 PrEST Antigen
Item number: ATA-APrEST96203.100
PrEST Antigen AP1M2, Gene description: adaptor related protein complex 1 subunit mu 2, Alternative Gene Names: AP1-mu2, HSMU1B, mu2, Antigen sequence: PYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLRTS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Subunit of clathrin-associated...
| Keywords: | AP1M2, Mu1B-adaptin, Mu-adaptin 2, AP-1 complex subunit mu-2, AP-mu chain family member mu1B, Adaptor protein complex AP-1... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*