- Search results for Q9Y5B8
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
19 products were found matching "Q9Y5B8"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA028334.100
Polyclonal Antibody against Human NME7, Gene description: NME/NM23 family member 7, Alternative Gene Names: CFAP67, FLJ37194, NM23-H7, Validated applications: ICC, WB, Uniprot ID: Q9Y5B8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Major role in the...
Keywords: | Anti-NME7, Anti-NDK 7, Anti-nm23-H7, EC=2.7.4.6, Anti-NDP kinase 7, Anti-Nucleoside diphosphate kinase 7 |
Application: | ICC, WB |
Host: | Rabbit |
Species reactivity: | human |
477.00€
*
Item number: CSB-PA250757.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: NME7. Antigen Species: Human
Keywords: | Anti-NME7, Anti-NDK 7, Anti-nm23-H7, EC=2.7.4.6, Anti-NDP kinase 7, Anti-Nucleoside diphosphate kinase 7, MN23H7 antibody,... |
Application: | ELISA, WB |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
From 167.00€
*
Item number: ATA-HPA038014.100
Protein function: Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is...
Keywords: | Anti-NME7, Anti-NDK 7, Anti-nm23-H7, EC=2.7.4.6, Anti-NDP kinase 7, Anti-Nucleoside diphosphate kinase 7 |
Application: | IHC, WB |
Host: | Rabbit |
Species reactivity: | human |
From 358.00€
*
Item number: ATA-HPA054289.100
Protein function: Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is...
Keywords: | Anti-NME7, Anti-NDK 7, Anti-nm23-H7, EC=2.7.4.6, Anti-NDP kinase 7, Anti-Nucleoside diphosphate kinase 7 |
Application: | ICC |
Host: | Rabbit |
Species reactivity: | human |
From 239.00€
*
Item number: NSJ-F54961-0.08ML
In 1X PBS, pH 7.4, with 0.09% sodium azide. Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells,...
Keywords: | Anti-NME7, Anti-NDK 7, Anti-nm23-H7, EC=2.7.4.6, Anti-NDP kinase 7, Anti-Nucleoside diphosphate kinase 7, NME7 Antibody /... |
Application: | WB, IHC (paraffin) |
Host: | Rabbit |
Species reactivity: | human |
From 350.00€
*

Item number: ATA-APrEST95650.100
PrEST Antigen NME7, Gene description: NME/NM23 family member 7, Alternative Gene Names: CFAP67, FLJ37194, NM23-H7, Antigen sequence: MNHSERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGNKVNVFSRQLVLIDYGDQYTARQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
Keywords: | NME7, NDK 7, nm23-H7, EC=2.7.4.6, NDP kinase 7, Nucleoside diphosphate kinase 7 |
Expressed in: | E.coli |
Origin: | human |
265.00€
*

Item number: ABS-PP-12048.100
Keywords: | Nucleoside diphosphate kinase 7, NDK 7, NDP kinase 7, nm23-H7, Recombinant Human NME7 Protein |
MW: | 22 kD |
From 90.00€
*

Item number: CSB-PA897289LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: NME7. Antigen Species: Human
Keywords: | Anti-NME7, Anti-NDK 7, Anti-nm23-H7, EC=2.7.4.6, Anti-NDP kinase 7, Anti-Nucleoside diphosphate kinase 7, MN23H7 antibody,... |
Host: | Rabbit |
Species reactivity: | human |
From 167.00€
*

Item number: CSB-PA897289LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: NME7. Antigen Species: Human
Keywords: | Anti-NME7, Anti-NDK 7, Anti-nm23-H7, EC=2.7.4.6, Anti-NDP kinase 7, Anti-Nucleoside diphosphate kinase 7, MN23H7 antibody,... |
Application: | ELISA, WB, IHC |
Host: | Rabbit |
Species reactivity: | human, mouse |
From 167.00€
*

Item number: CSB-PA897289LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: NME7. Antigen Species: Human
Keywords: | Anti-NME7, Anti-NDK 7, Anti-nm23-H7, EC=2.7.4.6, Anti-NDP kinase 7, Anti-Nucleoside diphosphate kinase 7, MN23H7 antibody,... |
Application: | ELISA |
Host: | Rabbit |
Species reactivity: | human |
From 167.00€
*

Item number: CSB-PA897289LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: NME7. Antigen Species: Human
Keywords: | Anti-NME7, Anti-NDK 7, Anti-nm23-H7, EC=2.7.4.6, Anti-NDP kinase 7, Anti-Nucleoside diphosphate kinase 7, MN23H7 antibody,... |
Application: | ELISA |
Host: | Rabbit |
Species reactivity: | human |
From 167.00€
*

Item number: CSB-CL897289HU.10
Length: 1131 Sequence: atgaatcata gtgaaagatt cgttttcatt gcagagtggt atgatccaaa tgcttcactt cttcgacgtt atgagctttt attttaccca ggggatggat ctgttgaaat gcatgatgta aagaatcatc gcaccttttt aaagcggacc aaatatgata acctgcactt ggaagattta tttataggca acaaagtgaa tgtcttctct cgacaactgg tattaattga ctatggggat caatatacag ctcgccagct...
Keywords: | NME7, NDK 7, nm23-H7, EC=2.7.4.6, NDP kinase 7, Nucleoside diphosphate kinase 7 |
Application: | Molecular biology, clone |
Species reactivity: | human |
176.00€
*