- Search results for Q9UL52
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
12 products were found matching "Q9UL52"!
Close filters
Filter by:
No results were found for the filter!
Item number: E-AB-17117.120
Serine protease which possesses both gelatinolytic and caseinolytic activities. Shows a preference for Arg in the P1 position (By similarity). Protein function: Serine protease which possesses both gelatinolytic and caseinolytic activities. Shows a preference for Arg in the P1 position. [The UniProt Consortium]
| Keywords: | Anti-DESC1, Anti-TMPRSS11E, EC=3.4.21.-, TMPRSS11E Polyclonal Antibody |
| Application: | IHC, ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 89.00€
*
Item number: NSJ-F40096-0.08ML
In 1X PBS, pH 7.4, with 0.09% sodium azide. TMPRSS11E is a serine protease which possesses both gelatinolytic and caseinolytic activities. Shows a preference for Arg in the P1 position (By similarity). Protein function: Serine protease which possesses both gelatinolytic and caseinolytic activities. Shows a...
| Keywords: | Anti-DESC1, Anti-TMPRSS11E, EC=3.4.21.-, TMPRSS11E2 Antibody |
| Application: | WB, ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 361.00€
*
Item number: ATA-HPA051062.100
Protein function: Serine protease which possesses both gelatinolytic and caseinolytic activities. Shows a preference for Arg in the P1 position. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 75% and to rat: 74%
| Keywords: | Anti-DESC1, Anti-TMPRSS11E, EC=3.4.21.- |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Item number: CSB-PA179468.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: TMPRSS11E. Antigen Species: Human
| Keywords: | Anti-DESC1, Anti-TMPRSS11E, EC=3.4.21.-, TMPRSS11E antibody, DESC1 antibody, TMPRSS11E2 antibody, UNQ742/PRO1461 antibody,... |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA744019.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: TMPRSS11E. Antigen Species: Human
| Keywords: | Anti-DESC1, Anti-TMPRSS11E, EC=3.4.21.-, TMPRSS11E antibody, DESC1 antibody, TMPRSS11E2 antibody, UNQ742/PRO1461 antibody,... |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: ATA-HPA043816.100
Polyclonal Antibody against Human TMPRSS11E, Gene description: transmembrane serine protease 11E, Alternative Gene Names: DESC1, TMPRSS11E2, Validated applications: ICC, Uniprot ID: Q9UL52, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Serine protease...
| Keywords: | Anti-DESC1, Anti-TMPRSS11E, EC=3.4.21.- |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ATA-HPA043816.25
Polyclonal Antibody against Human TMPRSS11E, Gene description: transmembrane serine protease 11E, Alternative Gene Names: DESC1, TMPRSS11E2, Validated applications: ICC, Uniprot ID: Q9UL52, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Serine protease...
| Keywords: | Anti-DESC1, Anti-TMPRSS11E, EC=3.4.21.- |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Item number: VHPS-2553
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | DESC1, TMPRSS11E, EC=3.4.21.-, Serine protease DESC1, Transmembrane protease serine 11E, Transmembrane protease serine... |
| Application: | RNA quantification |
45.00€
*
Item number: 043048.200
TMPRSS11E is serine protease which possesses both gelatinolytic and caseinolytic activities. Shows a preference for Arg in the P1 position (By similarity). Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C...
| Keywords: | Anti-DESC1, Anti-TMPRSS11E, EC=3.4.21.- |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
Item number: ATA-APrEST83233.100
Protein function: Serine protease which possesses both gelatinolytic and caseinolytic activities. Shows a preference for Arg in the P1 position. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | DESC1, TMPRSS11E, EC=3.4.21.- |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: CSB-CL892142HU.10
Length: 1272 Sequence: ATGATGTATC GGCCAGATGT GGTGAGGGCT AGGAAAAGAG TTTGTTGGGA ACCCTGGGTT ATCGGCCTCG TCATCTTCAT ATCCCTGATT GTCCTGGCAG TGTGCATTGG ACTCACTGTT CATTATGTGA GATATAATCA AAAGAAGACC TACAATTACT ATAGCACATT GTCATTTACA ACTGACAAAC TATATGCTGA GTTTGGCAGA GAGGCTTCTA ACAATTTTAC AGAAATGAGC CAGAGACTTG AATCAATGGT...
| Keywords: | DESC1, TMPRSS11E, EC=3.4.21.- |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
Item number: ATA-APrEST96228.100
PrEST Antigen TMPRSS11E, Gene description: transmembrane serine protease 11E, Alternative Gene Names: DESC1, TMPRSS11E2, Antigen sequence: NQKKTYNYYSTLSFTTDKLYAEFGREASNNFTEMSQRLESMVKNAFYKSPLREEFVKSQVIKFSQQKHGV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Serine...
| Keywords: | DESC1, TMPRSS11E, EC=3.4.21.- |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*