- Search results for Q9UIF8
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
11 products were found matching "Q9UIF8"!
Close filters
Filter by:
No results were found for the filter!
Item number: ARG63649.100
Protein function: May play a role in transcriptional regulation interacting with ISWI. [The UniProt Consortium]
Keywords: | Anti-BAZ2B, Anti-hWALp4, Anti-KIAA1476, Anti-Bromodomain adjacent to zinc finger domain protein 2B |
Application: | ELISA, IHC (paraffin) |
Host: | Goat |
Species reactivity: | human |
784.00€
*
Item number: BPS-31113
Human Bromodomain adjacent to zinc finger domain, 2B or BAZ2B, amino-acids 2054 ? 2168 (end), GenBank Accession No. NM_013450 with N-terminal HIS-tag, MW = 14.3 kDa, expressed in an E. coli expression system.
Keywords: | BAZ2B, hWALp4, KIAA1476, Bromodomain adjacent to zinc finger domain protein 2B, |
Application: | BRD binding assays, inhibitor screening, selectivity profiling |
Expressed in: | E.coli |
Origin: | human |
MW: | 15.1 kD |
452.00€
*
Item number: BPS-32600
The BAZ2B Inhibitor Screening Assay Kit is designed to measure the inhibition of BAZ2B bromodomain binding to its substrate. The kit comes in a convenient AlphaLISA(R) format, with biotinylated histone peptide substrate, assay buffer, detection buffer and purified BAZ2B for 384 assays.
Keywords: | BAZ2B, hWALp4, KIAA1476, Bromodomain adjacent to zinc finger domain protein 2B |
Application: | BAZ2B iInhibitor screening |
752.00€
*
Item number: NSJ-R36365-100UG
0.5 mg/ml in 1X TBS, pH7.3, with 0.5% BSA (US sourced) and 0.02% sodium azide. Additional name(s) for this target protein: Bromodomain adjacent to zinc finger domain, 2B Protein function: May play a role in transcriptional regulation interacting with ISWI. [The UniProt Consortium]
Keywords: | Anti-BAZ2B, Anti-hWALp4, Anti-KIAA1476, Anti-Bromodomain adjacent to zinc finger domain protein 2B, BAZ2B Antibody |
Application: | IHC, ELISA (peptide) |
Host: | Goat |
Species reactivity: | human |
755.00€
*
Item number: G-PACO57536.50
BAZ2B Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC, IF applications. BAZ2B Antibody is a high quality polyclonal antibody for research use only.. Protein function: May play a role in transcriptional regulation interacting with ISWI. [The UniProt...
Keywords: | Anti-BAZ2B, Anti-hWALp4, Anti-KIAA1476, Anti-Bromodomain adjacent to zinc finger domain protein 2B |
Application: | ELISA, IHC, IF |
Host: | Rabbit |
Species reactivity: | human |
363.00€
*
Item number: ATA-HPA019819.100
Protein function: May play a role in transcriptional regulation interacting with ISWI. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 75% and to rat: 75%
Keywords: | Anti-BAZ2B, Anti-hWALp4, Anti-KIAA1476, Anti-Bromodomain adjacent to zinc finger domain protein 2B |
Application: | IHC |
Host: | Rabbit |
Species reactivity: | human |
From 335.00€
*
Item number: ATA-HPA059292.100
Protein function: May play a role in transcriptional regulation interacting with ISWI. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 91% and to rat: 89%
Keywords: | Anti-BAZ2B, Anti-hWALp4, Anti-KIAA1476, Anti-Bromodomain adjacent to zinc finger domain protein 2B |
Application: | ICC |
Host: | Rabbit |
Species reactivity: | human |
From 335.00€
*
Item number: Cay600506-12.5
Formulation: A lyophilized powder.
Application: | Kit component |
From 34.00€
*
Item number: 298333.100
BAZ2B (Bromodomain Adjacent To Zinc Finger Domain, 2B) is a Protein Coding gene. Source: Recombinant protein corresponding to aa2054-2168 from human BAZ2B, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~14.3kD, AA Sequence: MHHHHHHSVKKPKRDDSKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKVIKKP,...
Keywords: | BAZ2B, hWALp4, KIAA1476, Bromodomain adjacent to zinc finger domain protein 2B |
MW: | 14,3 |
916.00€
*
Item number: ATA-APrEST73703.100
Protein function: May play a role in transcriptional regulation interacting with ISWI. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
Keywords: | BAZ2B, hWALp4, KIAA1476, Bromodomain adjacent to zinc finger domain protein 2B |
Application: | Control antigen |
Expressed in: | E.coli |
Origin: | human |
247.00€
*
Item number: ATA-APrEST91988.100
Protein function: May play a role in transcriptional regulation interacting with ISWI. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
Keywords: | BAZ2B, hWALp4, KIAA1476, Bromodomain adjacent to zinc finger domain protein 2B |
Application: | Control antigen |
Expressed in: | E.coli |
Origin: | human |
247.00€
*