- Search results for Q9P0X4
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
11 products were found matching "Q9P0X4"!
Close filters
Filter by:
No results were found for the filter!
Item number: G-PACO07169.50
CACNA1I Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in ELISA, IHC applications. CACNA1I Antibody is a high quality polyclonal antibody for research use only.. Protein function: Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions...
| Keywords: | Anti-CACNA1I, Anti-KIAA1120, Anti-Ca(v)3.3, Anti-Voltage-gated calcium channel subunit alpha Cav3.3,... |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
225.00€
*
Item number: ELK-EA273.50
Voltage-gated Ca2+ channels (CaV), enable the passage of Ca2+ ions in a voltage dependent manner. These heteromeric entities are formed in part by the pore-forming alpha1 subunit which determines the biophysical and pharmacological properties of the channel. Protein function: Voltage-sensitive calcium channels...
| Keywords: | Anti-CACNA1I, Anti-Ca(v)3.3, Anti-KIAA1120, Anti-Voltage-gated calcium channel subunit alpha Cav3.3,... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
173.00€
*
Item number: CSB-PA413190.50
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using specific immunogen....
| Keywords: | Anti-CACNA1I, Anti-KIAA1120, Anti-Ca(v)3.3, Anti-Voltage-gated calcium channel subunit alpha Cav3.3,... |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
126.00€
*
Item number: ATA-HPA066992.100
Polyclonal Antibody against Human CACNA1I, Gene description: calcium voltage-gated channel subunit alpha1 I, Alternative Gene Names: Cav3.3, Validated applications: ICC, Uniprot ID: Q9P0X4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Voltage-sensitive...
| Keywords: | Anti-CACNA1I, Anti-KIAA1120, Anti-Ca(v)3.3, Anti-Voltage-gated calcium channel subunit alpha Cav3.3,... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ABS-PP-4567-L.100
Protein function: Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. This...
| Keywords: | Voltage-dependent T-type calcium channel subunit alpha-1I, Voltage-gated calcium channel subunit alpha Cav3.3, Ca(v)3.3,... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 10 kD |
From 115.00€
*
Item number: G-HDFP652.10
Protein function: Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. This...
| Keywords: | CACNA1I, KIAA1120, Ca(v)3.3, Voltage-gated calcium channel subunit alpha Cav3.3, Voltage-dependent T-type calcium channel... |
| Expressed in: | Human cells |
| Origin: | human |
1,693.00€
*
Item number: VHPS-1453
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | CACNA1I, Ca(v)3.3, KIAA1120, Voltage-gated calcium channel subunit alpha Cav3.3, Voltage-dependent T-type calcium channel... |
| Application: | RNA quantification |
45.00€
*
Item number: ELK-ES20794.100
calcium voltage-gated channel subunit alpha1 I(CACNA1I) Homo sapiens This gene encodes the pore-forming alpha subunit of a voltage gated calcium channel. The encoded protein is a member of a subfamily of calcium channels referred to as is a low voltage-activated, T-type, calcium channel. The channel encoded by this...
| Keywords: | Anti-CACNA1I, Anti-Ca(v)3.3, Anti-KIAA1120, Anti-Voltage-gated calcium channel subunit alpha Cav3.3,... |
| Application: | IHC, IF |
| Host: | Rabbit |
| Species reactivity: | human, rat, mouse |
From 173.00€
*
Item number: ABS-PP-4567.100
Protein function: Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. This...
| Keywords: | Voltage-dependent T-type calcium channel subunit alpha-1I, Voltage-gated calcium channel subunit alpha Cav3.3, Ca(v)3.3,... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 10 kD |
From 90.00€
*
Item number: ATA-APrEST95994.100
PrEST Antigen CACNA1I, Gene description: calcium voltage-gated channel subunit alpha1 I, Alternative Gene Names: Cav3.3, Antigen sequence: HHDKQEVQLAETEAFSLNSDRSSSILLGDDLSLEDPTACPPGRKDSKGELDPPEPMRVGDLGECFFPLSSTAVSPDPENFLCEMEEIPFNPVR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Keywords: | CACNA1I, KIAA1120, Ca(v)3.3, Voltage-gated calcium channel subunit alpha Cav3.3, Voltage-dependent T-type calcium channel... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: DIM-FLP120744.10
This gene encodes the pore-forming alpha subunit of a voltage gated calcium channel. The encoded protein is a member of a subfamily of calcium channels referred to as is a low voltage-activated, T-type, calcium channel. The channel encoded by this protein is characterized by a slower activation and inactivation...
| Keywords: | CACNA1I, KIAA1120, Ca(v)3.3, Voltage-gated calcium channel subunit alpha Cav3.3, Voltage-dependent T-type calcium channel... |
| Application: | Full length transmembrane protein, FA, ELISA, screening, immunization, cell-based assays, crystallization |
| Expressed in: | Human cells |
| Origin: | human |
| MW: | 245.1 kD |
From 1,185.00€
*