- Search results for Q9NX36
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
11 products were found matching "Q9NX36"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA018003.100
Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 89% and to rat: 87%
| Keywords: | Anti-DNAJC28, Anti-C21orf55, Anti-DnaJ homolog subfamily C member 28 |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Item number: ATA-HPA030076.100
Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 64% and to rat: 62%
| Keywords: | Anti-DNAJC28, Anti-C21orf55, Anti-DnaJ homolog subfamily C member 28 |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Item number: ATA-HPA077153.100
Polyclonal Antibody against Human DNAJC28, Gene description: DnaJ heat shock protein family (Hsp40) member C28, Alternative Gene Names: C21orf55, C21orf78, Validated applications: ICC, Uniprot ID: Q9NX36, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May...
| Keywords: | Anti-DNAJC28, Anti-C21orf55, Anti-DnaJ homolog subfamily C member 28 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
NEW
Item number: ATA-HPA077153.25
Polyclonal Antibody against Human DNAJC28, Gene description: DnaJ heat shock protein family (Hsp40) member C28, Alternative Gene Names: C21orf55, C21orf78, Validated applications: ICC, Uniprot ID: Q9NX36, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May...
| Keywords: | Anti-DNAJC28, Anti-C21orf55, Anti-DnaJ homolog subfamily C member 28 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Item number: ABS-PP-6754-L.100
Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium]
| Keywords: | DnaJ homolog subfamily C member 28, Recombinant Human DNAJC28 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 18.5 kD |
From 115.00€
*
Item number: VHPS-1239
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | DNAJC28, C21orf55, DnaJ homolog subfamily C member 28 |
| Application: | RNA quantification |
45.00€
*
Item number: 034719.200
DNAJC28 may have a role in protein folding or as a chaperone. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots...
| Keywords: | Anti-DNAJC28, Anti-C21orf55, Anti-DnaJ homolog subfamily C member 28 |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
Item number: ATA-APrEST73895.100
Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | DNAJC28, C21orf55, DnaJ homolog subfamily C member 28 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ATA-APrEST78840.100
Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | DNAJC28, C21orf55, DnaJ homolog subfamily C member 28 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ABS-PP-6754.100
Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium]
| Keywords: | DnaJ homolog subfamily C member 28, Recombinant Human DNAJC28 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 18.5 kD |
From 90.00€
*
Item number: ATA-APrEST96141.100
PrEST Antigen DNAJC28, Gene description: DnaJ heat shock protein family (Hsp40) member C28, Alternative Gene Names: C21orf55, C21orf78, Antigen sequence: VLSHVIEQTNASQSKGEEEEDVEKFKYKTPQHRHYLSFEGIGFGTPTQREKHYRQFRADRAAEQVMEYQKQKLQSQYFPDSVIVKNIRQSKQQKITQAI, Storage: Upon delivery store at -20°C. Avoid repeated...
| Keywords: | DNAJC28, C21orf55, DnaJ homolog subfamily C member 28 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*