17 products were found matching "Q9NSI6"!

Protein function: May be a transcriptional activator. May be involved in chromatin remodeling. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape. [The UniProt Consortium]

Human bromodomain and WD repeat domain containing 1 (BRWD1) or WDR9, amino-acids 1308 - 1436, (GenBank Accession No. NM_018963) with N-terminal HIS-tag, MW = 16.2 kDa, expressed in an E. coli expression system.

Human bromodomain and WD repeat domain containing 1 (BRWD1) or WDR9, amino acids 1308 - 1436, (GenBank Accession No. NM_018963) with N-terminal GST-tag, MW = 42 kDa, expressed in an E. coli expression system.

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD) residues which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a...

WB 1:1000 - 1:3000. Protein function: May be a transcriptional activator. May be involved in chromatin remodeling. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape. [The UniProt Consortium]

BRWD1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse and for use in ELISA, IHC applications. BRWD1 Antibody is a high quality polyclonal antibody for research use only.. Protein function: May be a transcriptional activator. May be involved in chromatin remodeling. Plays a...

BRWD1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse and for use in ELISA, IHC applications. BRWD1 Antibody is a high quality polyclonal antibody for research use only.. Protein function: May be a transcriptional activator. May be involved in chromatin remodeling. Plays a...

Protein function: May be a transcriptional activator. May be involved in chromatin remodeling. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as...

Protein function: May be a transcriptional activator. May be involved in chromatin remodeling. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as...

Protein function: May be a transcriptional activator. May be involved in chromatin remodeling. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as...

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....

Source:, Recombinant protein corresponding to bromodomain 2, aa1308-1436, from human WDR9, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~42kD, AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI, DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK,...