19 products were found matching "Q9NSI6"!

1 from 2 pages
No results were found for the filter!
Anti-BRWD1 / WDR9
Anti-BRWD1 / WDR9

Item number: ARG57407.100

Protein function: May be a transcriptional activator. May be involved in chromatin remodeling. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape. [The UniProt Consortium]
Keywords: Anti-BRWD1, Anti-C21orf107, Anti-WD repeat-containing protein 9, Anti-Bromodomain and WD repeat-containing protein 1
Application: WB
Host: Rabbit
Species reactivity: human, mouse
707.00€ *
Review
WRD9 (1308-1436), human recombinant protein, N-terminal His tag
WRD9 (1308-1436), human recombinant protein, N-terminal...

Item number: BPS-31115

Human bromodomain and WD repeat domain containing 1 (BRWD1) or WDR9, amino-acids 1308 - 1436, (GenBank Accession No. NM_018963) with N-terminal HIS-tag, MW = 16.2 kDa, expressed in an E. coli expression system.
Keywords: BRWD1, C21orf107, WD repeat-containing protein 9, Bromodomain and WD repeat-containing protein 1,
Application: BRD binding assays, inhibitor screening, selectivity profiling
Expressed in: E.coli
Origin: human
MW: 16.2 kD
461.00€ *
Review
WDR9 (BRWD1), human recombinant protein, N-terminal GST-tag
WDR9 (BRWD1), human recombinant protein, N-terminal GST-tag

Item number: BPS-31135

Human bromodomain and WD repeat domain containing 1 (BRWD1) or WDR9, amino acids 1308 - 1436, (GenBank Accession No. NM_018963) with N-terminal GST-tag, MW = 42 kDa, expressed in an E. coli expression system.
Keywords: BRWD1, C21orf107, WD repeat-containing protein 9, Bromodomain and WD repeat-containing protein 1,
Application: Bromodomain binding assays, screening inhibitors, selectivity profiling
Expressed in: E.coli
Origin: human
MW: 42 kD
461.00€ *
Review
Anti-BRWD1
Anti-BRWD1

Item number: ATA-HPA030943.100

Protein function: May be a transcriptional activator. May be involved in chromatin remodeling. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as...
Keywords: Anti-BRWD1, Anti-C21orf107, Anti-WD repeat-containing protein 9, Anti-Bromodomain and WD repeat-containing protein 1
Application: IHC
Host: Rabbit
Species reactivity: human
From 369.00€ *
Review
Anti-BRWD1
Anti-BRWD1

Item number: ATA-HPA030944.100

Protein function: May be a transcriptional activator. May be involved in chromatin remodeling. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as...
Keywords: Anti-BRWD1, Anti-C21orf107, Anti-WD repeat-containing protein 9, Anti-Bromodomain and WD repeat-containing protein 1
Application: ICC, IHC
Host: Rabbit
Species reactivity: human
From 369.00€ *
Review
Anti-BRWD1
Anti-BRWD1

Item number: ATA-HPA030945.100

Protein function: May be a transcriptional activator. May be involved in chromatin remodeling. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as...
Keywords: Anti-BRWD1, Anti-C21orf107, Anti-WD repeat-containing protein 9, Anti-Bromodomain and WD repeat-containing protein 1
Application: IHC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
Anti-BRWD1
Anti-BRWD1

Item number: CSB-PA175261.100

Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: BRWD1. Antigen Species: Human
Keywords: Anti-BRWD1, Anti-C21orf107, Anti-WD repeat-containing protein 9, Anti-Bromodomain and WD repeat-containing protein 1,...
Application: ELISA, IHC
Host: Rabbit
Species reactivity: human, mouse
From 167.00€ *
Review
Anti-BRWD1
Anti-BRWD1

Item number: CSB-PA198192.100

Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: BRWD1. Antigen Species: Human
Keywords: Anti-BRWD1, Anti-C21orf107, Anti-WD repeat-containing protein 9, Anti-Bromodomain and WD repeat-containing protein 1,...
Application: ELISA, IHC
Host: Rabbit
Species reactivity: human, mouse
From 167.00€ *
Review
NEW
Anti-BRWD1
Anti-BRWD1

Item number: E-AB-64293.120

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD) residues which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a...
Keywords: Anti-BRWD1, Anti-C21orf107, Anti-WD repeat-containing protein 9, Anti-Bromodomain and WD repeat-containing protein 1,...
Application: WB
Host: Rabbit
Species reactivity: human, mouse
From 243.00€ *
Review
Anti-BRWD1
Anti-BRWD1

Item number: ATA-HPA030945.25

Protein function: May be a transcriptional activator. May be involved in chromatin remodeling. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as...
Keywords: Anti-BRWD1, Anti-C21orf107, Anti-WD repeat-containing protein 9, Anti-Bromodomain and WD repeat-containing protein 1
Application: IHC
Host: Rabbit
Species reactivity: human
361.00€ *
Review
C21orf107, Human, Real Time PCR Primer Set
C21orf107, Human, Real Time PCR Primer Set

Item number: VHPS-1223

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: BRWD1, C21orf107, WD repeat-containing protein 9, Bromodomain and WD repeat-containing protein 1
Application: RNA quantification
45.00€ *
Review
WDR9 (BD2), Recombinant, Human, aa1308-1436, GST-tag (Bromodomain and WD Repeat Domain Containing 1,
WDR9 (BD2), Recombinant, Human, aa1308-1436, GST-tag...

Item number: 298491.100

Source:, Recombinant protein corresponding to bromodomain 2, aa1308-1436, from human WDR9, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~42kD, AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI, DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK,...
Keywords: BRWD1, C21orf107, WD repeat-containing protein 9, Bromodomain and WD repeat-containing protein 1
MW: 42
960.00€ *
Review
1 from 2 pages