12 products were found matching "Q9H665"!
No results were found for the filter!
IGFLR1 (human):Fc (human) (rec.)
Item number: AG-40B-0087-C050
Human IGFLR1 (aa 23-154) is fused at the C-terminus to the Fc portion of human IgG1. Lyophilized. Contains PBS. Insulin-growth factor-like gene family is a new family of proteins consisting of four proteins in humans (IGFL1 to 4) and one in mice (mIGFL). mIGFL is expressed in normal skin in mice and further...
| Keywords: | IGF-like Family Receptor 1, Transmembrane Protein 149, TMEM149, U2 Small Nuclear RNA Auxiliary Factor 1-like 4 |
| Application: | Bioassays |
| Expressed in: | Human cells |
| Origin: | human |
| MW: | 50 kD |
484.00€
*
IGF-like family receptor 1 (IGFLR1), partial (Active),...
Item number: CSB-MP862025HU.1
Organism: Homo sapiens (Human). Source: Mammalian cell. Expression Region: 23-163aa. Protein Length: Partial. Tag Info: C-terminal 6xHis-tagged. Target Protein Sequence: SQYCGRLEYW NPDNKCCSSC LQRFGPPPCP DYEFRENCGL NDHGDFVTPP FRKCSSGQCN PDGAELCSPC GGGAVTPTPA AGGGRTPWRC RERPVPAKGH CPLTPGNPGA PSSQERSSPA SSIAWRTPEP...
| Keywords: | IGFLR1, TMEM149, Transmembrane protein 149, IGF-like family receptor 1, U2 small nuclear RNA auxiliary factor 1-like 4,... |
| Application: | Active protein |
| Expressed in: | Mammalian cells |
| Origin: | human |
| MW: | 17.4 kD |
From 142.00€
*
IGF-like family receptor 1 (IGFLR1), partial (Active),...
Item number: CSB-MP862025HUd9.1
Organism: Homo sapiens (Human). Source: Mammalian cell. Expression Region: 23-163aa. Protein Length: Partial. Tag Info: C-terminal hFc-tagged. Target Protein Sequence: SQYCGRLEYW NPDNKCCSSC LQRFGPPPCP DYEFRENCGL NDHGDFVTPP FRKCSSGQCN PDGAELCSPC GGGAVTPTPA AGGGRTPWRC RERPVPAKGH CPLTPGNPGA PSSQERSSPA SSIAWRTPEP...
| Keywords: | IGFLR1, TMEM149, Transmembrane protein 149, IGF-like family receptor 1, U2 small nuclear RNA auxiliary factor 1-like 4,... |
| Application: | Active protein |
| Expressed in: | Mammalian cells |
| Origin: | human |
| MW: | 44.1 kD |
From 142.00€
*
IGFLR1 Protein, Human, Recombinant (His)
Item number: TGM-TMPH-01515-100ug
Description: Probable cell membrane receptor for the IGF-like family proteins. Binds IGFL1 and IGFL3 with a higher affinity. May also bind IGFL2.
| Keywords: | IGFLR1, U2 small nuclear RNA auxiliary factor 1-like 4, Transmembrane protein 149, IGF-like family receptor 1 |
| MW: | 17.4 kD |
From 120.00€
*
IGFLR1 Protein, Human, Recombinant (hFc)
Item number: TGM-TMPY-04160-100ug
Description: IGFLR1 Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 41.4 kDa and the accession number is Q9H665-1.
| Keywords: | IGFLR1, IGF-like family receptor 1, U2AF1L4, TMEM149 |
| MW: | 41.4 kD |
768.00€
*
Anti-IGFLR1
Item number: ATA-HPA070778.100
Polyclonal Antibody against Human IGFLR1, Gene description: IGF like family receptor 1, Alternative Gene Names: FLJ22573, TMEM149, U2AF1L4, Validated applications: ICC, Uniprot ID: Q9H665, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Probable cell...
| Keywords: | Anti-IGFLR1, Anti-TMEM149, Anti-Transmembrane protein 149, Anti-IGF-like family receptor 1, Anti-U2 small nuclear RNA... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
NEW
IGFLR1 Protein, Human, Recombinant (His)
Item number: TGM-TMPH-01515-10ug
Description: Probable cell membrane receptor for the IGF-like family proteins. Binds IGFL1 and IGFL3 with a higher affinity. May also bind IGFL2.
| Keywords: | IGFLR1 , TMEM149 , U2AF1L4 , Transmembrane protein 149 , IGF-like family receptor 1 , U2 small nuclear RNA auxiliary... |
| MW: | 17.4 kD |
From 48.00€
*
NEW
IGFLR1 Protein, Human, Recombinant (hFc)
Item number: TGM-TMPY-04160-10ug
Description: IGFLR1 Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 41.4 kDa and the accession number is Q9H665-1.
| Keywords: | IGFLR1 , IGF-like family receptor 1 , U2AF1L4 , TMEM149 |
| MW: | 41.4 kD |
From 75.00€
*
Anti-IGFLR1 (human), pAb (IN101)
Item number: AG-25B-0026-C100
Insulin-growth factor-like gene family is a new family of proteins consisting of four proteins in humans (IGFL1 to 4) and one in mice (mIGFL). mIGFL is expressed in normal skin in mice and further upregulated during inflammation responses in skin or after skin wounding. In human only IGFL1 expression is increased in...
| Keywords: | IGF-like Family Receptor 1, Transmembrane Protein 149, TMEM149, U2 Small Nuclear RNA Auxiliary Factor 1-like 4 |
| Application: | FC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
171.00€
*
TMEM149, Human transmembrane protein 149, Real Time PCR...
Item number: VHPS-9355
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | IGFLR1, TMEM149, Transmembrane protein 149, IGF-like family receptor 1, U2 small nuclear RNA auxiliary factor 1-like 4 |
| Application: | RNA quantification |
45.00€
*
Anti-IGFR1
Item number: ELK-ES15510.100
Protein function: Probable cell membrane receptor for the IGF-like family proteins. Binds IGFL1 and IGFL3 with a higher affinity. May also bind IGFL2. [The UniProt Consortium] Recommended dilutions: WB 1:500-2000. Cellular localization: Cell membrane , Single-pass type I membrane protein .
| Keywords: | Anti-IGFLR1, Anti-TMEM149, Anti-Transmembrane protein 149, Anti-IGF-like family receptor 1, Anti-U2 small nuclear RNA... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 173.00€
*
IGFLR1 PrEST Antigen
Item number: ATA-APrEST96115.100
PrEST Antigen IGFLR1, Gene description: IGF like family receptor 1, Alternative Gene Names: FLJ22573, TMEM149, U2AF1L4, Antigen sequence: LEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Probable cell membrane...
| Keywords: | IGFLR1, TMEM149, Transmembrane protein 149, IGF-like family receptor 1, U2 small nuclear RNA auxiliary factor 1-like 4 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*