12 products were found matching "Q9H4Q3"!

No results were found for the filter!
Anti-PRDM13
Anti-PRDM13

Item number: G-PACO53566.50

PRDM13 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse and for use in ELISA, WB applications. PRDM13 Antibody is a high quality polyclonal antibody for research use only.. Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]
Keywords: Anti-PFM10, Anti-PRDM13, EC=2.1.1.-, Anti-PR domain-containing protein 13, Anti-PR domain zinc finger protein 13
Application: ELISA, WB
Host: Rabbit
Species reactivity: human, mouse
313.00€ *
Review
Anti-PRDM13
Anti-PRDM13

Item number: ATA-HPA069705.100

Polyclonal Antibody against Human PRDM13, Gene description: PR/SET domain 13, Alternative Gene Names: PFM10, Validated applications: ICC, Uniprot ID: Q9H4Q3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May be involved in transcriptional regulation. [The...
Keywords: Anti-PFM10, Anti-PRDM13, EC=2.1.1.-, Anti-PR domain-containing protein 13, Anti-PR domain zinc finger protein 13
Application: ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
Anti-PRDM13
Anti-PRDM13

Item number: ATA-HPA062648.100

Polyclonal Antibody against Human PRDM13, Gene description: PR/SET domain 13, Alternative Gene Names: PFM10, Validated applications: ICC, Uniprot ID: Q9H4Q3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May be involved in transcriptional regulation. [The...
Keywords: Anti-PFM10, Anti-PRDM13, EC=2.1.1.-, Anti-PR domain-containing protein 13, Anti-PR domain zinc finger protein 13
Application: ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
Anti-PRDM13
Anti-PRDM13

Item number: ATA-HPA069705.25

Polyclonal Antibody against Human PRDM13, Gene description: PR/SET domain 13, Alternative Gene Names: PFM10, Validated applications: ICC, Uniprot ID: Q9H4Q3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May be involved in transcriptional regulation. [The...
Keywords: Anti-PFM10, Anti-PRDM13, EC=2.1.1.-, Anti-PR domain-containing protein 13, Anti-PR domain zinc finger protein 13
Application: ICC
Host: Rabbit
Species reactivity: human
361.00€ *
Review
Anti-PRDM13
Anti-PRDM13

Item number: ATA-HPA062648.25

Polyclonal Antibody against Human PRDM13, Gene description: PR/SET domain 13, Alternative Gene Names: PFM10, Validated applications: ICC, Uniprot ID: Q9H4Q3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May be involved in transcriptional regulation. [The...
Keywords: Anti-PFM10, Anti-PRDM13, EC=2.1.1.-, Anti-PR domain-containing protein 13, Anti-PR domain zinc finger protein 13
Application: ICC
Host: Rabbit
Species reactivity: human
361.00€ *
Review
Anti-PRDM13, FITC conjugated
Anti-PRDM13, FITC conjugated

Item number: CSB-PA887981LC01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: PRDM13. Antigen Species: Human
Keywords: Anti-PFM10, Anti-PRDM13, EC=2.1.1.-, Anti-PR domain-containing protein 13, Anti-PR domain zinc finger protein 13, PRDM13...
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Anti-PRDM13
Anti-PRDM13

Item number: CSB-PA887981LA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: PRDM13. Antigen Species: Human
Keywords: Anti-PFM10, Anti-PRDM13, EC=2.1.1.-, Anti-PR domain-containing protein 13, Anti-PR domain zinc finger protein 13, PRDM13...
Application: ELISA, WB
Host: Rabbit
Species reactivity: human, mouse
From 167.00€ *
Review
Anti-PRDM13, Biotin conjugated
Anti-PRDM13, Biotin conjugated

Item number: CSB-PA887981LD01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: PRDM13. Antigen Species: Human
Keywords: Anti-PFM10, Anti-PRDM13, EC=2.1.1.-, Anti-PR domain-containing protein 13, Anti-PR domain zinc finger protein 13, PRDM13...
Application: ELISA
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Anti-PRDM13, HRP conjugated
Anti-PRDM13, HRP conjugated

Item number: CSB-PA887981LB01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: PRDM13. Antigen Species: Human
Keywords: Anti-PFM10, Anti-PRDM13, EC=2.1.1.-, Anti-PR domain-containing protein 13, Anti-PR domain zinc finger protein 13, PRDM13...
Application: ELISA
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
PRDM13 (human), recombinant protein
PRDM13 (human), recombinant protein

Item number: ABS-PP-10331.100

Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]
Keywords: PR domain zinc finger protein 13, PR domain-containing protein 13, Recombinant Human PRDM13 Protein
Expressed in: E.coli
Origin: human
MW: 18 kD
From 90.00€ *
Review
PRDM13 PrEST Antigen
PRDM13 PrEST Antigen

Item number: ATA-APrEST96061.100

PrEST Antigen PRDM13, Gene description: PR/SET domain 13, Alternative Gene Names: PFM10, Antigen sequence: PLEWIGLIRAARNSQEQTLEAIADLPGGQIFYRALRDVQPGEELTVWYSNSLAQWFDIPTTATPTHDEKGEERYICWYCW, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May be involved in transcriptional...
Keywords: PFM10, PRDM13, EC=2.1.1.-, PR domain-containing protein 13, PR domain zinc finger protein 13
Expressed in: E.coli
Origin: human
264.00€ *
Review
PRDM13 (human), recombinant protein
PRDM13 (human), recombinant protein

Item number: ABS-PP-10331-L.100

Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]
Keywords: PR domain zinc finger protein 13, PR domain-containing protein 13, Recombinant Human PRDM13 Protein
Expressed in: E.coli
Origin: human
MW: 18 kD
From 115.00€ *
Review