14 products were found matching "Q9EQ21"!

1 from 2 pages
No results were found for the filter!
-10 %
Discount Promotion
Mouse Hepc (Hepcidin) ELISA Kit
Mouse Hepc (Hepcidin) ELISA Kit

Item number: ELK-ELK8198.48

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse Hepc. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse Hepc. Next,...
Keywords: Hamp, Hamp1, Hepcidin
Application: ELISA
Species reactivity: mouse
365.00€ * From 328.50€ *
Review
Mouse Hepc (Hepcidin) ELISA Kit
Mouse Hepc (Hepcidin) ELISA Kit

Item number: E-EL-M0671.96

The kit is a Sandwich enzyme immunoassay for in vitro quantitative measurement of Hepc in serum, plasma and other biological fluids. Detection Range: 125--8000pg/mL. Sensitivity: 75pg/mL. Protein function: Liver-produced hormone that constitutes the main circulating regulator of iron absorption and distribution...
Keywords: Hamp, Hamp1, Hepcidin
Application: ELISA
Species reactivity: mouse
392.00€ *
Review
Mouse Hepcidin ELISA Kit
Mouse Hepcidin ELISA Kit

Item number: G-MOFI00889.96

Application: ELISA
Species reactivity: mouse
694.00€ *
Review
Mouse Hepc (Hepcidin) CLIA Kit
Mouse Hepc (Hepcidin) CLIA Kit

Item number: E-CL-M0415.96

Type: Sandwich. Detection Range: 31.25~2000pg/mL. Sensitivity: 18.75pg/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Mouse Hepc . Standards or...
Keywords: Hamp, Hamp1, Hepcidin
Application: CLIA
Species reactivity: mouse
541.00€ *
Review
Mouse Hepc (Hepcidin) CLIA Kit
Mouse Hepc (Hepcidin) CLIA Kit

Item number: G-MOES00365.96

ELISA Type: CLIA. Sensitivity: 18.75 pg/mL. Range: 31.25--2000 pg/mL. Protein function: Liver-produced hormone that constitutes the main circulating regulator of iron absorption and distribution across tissues. Acts by promoting endocytosis and degradation of ferroportin, leading to the retention of iron in...
Keywords: Hamp, Hamp1, Hepcidin
Application: CLIA
Species reactivity: mouse
694.00€ *
Review
Mouse Hepc (Hepcidin) ELISA Kit
Mouse Hepc (Hepcidin) ELISA Kit

Item number: G-MOES01173.96

ELISA Type: Sandwich. Sensitivity: 75pg/mL. Range: 125--8000pg/mL. Protein function: Liver-produced hormone that constitutes the main circulating regulator of iron absorption and distribution across tissues. Acts by promoting endocytosis and degradation of ferroportin, leading to the retention of iron in...
Keywords: Hamp, Hamp1, Hepcidin
Application: Sandwich ELISA
Species reactivity: mouse
534.00€ *
Review
Hepcidin/Hepc protein (TRX,His tag), recombinant mouse
Hepcidin/Hepc protein (TRX,His tag), recombinant mouse

Item number: E-PDEM100034.100

Activity: Testing in progress Protein Construction: A DNA sequence encoding the Mouse Hepc protein (Q9EQ21) (Asp59-Thr83) was expressed with a N terminal His-TRX tag. Sequence: Asp59-Thr83. Fusion tag: N-Trx-His Endotoxin: Please contact us for more information. Apparent Molecular Mass: 25 kDa. Protein function:...
Keywords: Hamp, Hamp1, Hepcidin, Recombinant Mouse Hepcidin/Hepc protein (TRX,His tag)
Expressed in: E.coli
Origin: mouse
MW: 22.64 kD
From 81.00€ *
Review
Mouse Hepc (Hepcidin) ELISA Kit
Mouse Hepc (Hepcidin) ELISA Kit

Item number: E-EL-M0671.24

The kit is a Sandwich enzyme immunoassay for in vitro quantitative measurement of Hepc in serum, plasma and other biological fluids. Detection Range: 125--8000pg/mL. Sensitivity: 75pg/mL. Protein function: Liver-produced hormone that constitutes the main circulating regulator of iron absorption and distribution...
Keywords: Hamp, Hamp1, Hepcidin
Application: ELISA
Species reactivity: mouse
From 118.00€ *
Review
Mouse Hepc (Hepcidin) CLIA Kit
Mouse Hepc (Hepcidin) CLIA Kit

Item number: E-CL-M0415.24

Type: Sandwich. Detection Range: 31.25~2000pg/mL. Sensitivity: 18.75pg/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Mouse Hepc . Standards or...
Keywords: Hamp, Hamp1, Hepcidin
Application: CLIA
Species reactivity: mouse
From 142.00€ *
Review
Hamp, Mouse hepcidin antimicrobial peptide, Real Time PCR Primer Set
Hamp, Mouse hepcidin antimicrobial peptide, Real Time PCR...

Item number: VMPS-2718

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: Hamp, Hamp1, Hepcidin
Application: RNA quantification
43.00€ *
Review
Hepcidin (Hepc) BioAssay(TM) ELISA Kit (Mouse)
Hepcidin (Hepc) BioAssay(TM) ELISA Kit (Mouse)

Item number: 025650.96

Hepcidin (Hepc) BioAssay(TM) ELISA Kit (Mouse) is a sandwich enzyme immunoassay for in vitro quantitative measurement of Hepc in mouse serum, plasma, urine and other biological fluids. Detection Range: 62.5-4,000pg/ml, Sensitivity: 27.2pg/ml, Storage and Stability: Desiccation recommended. The Standard, Detection...
Keywords: Hamp, Hamp1, Hepcidin
Application: ELISA
Species reactivity: mouse
1,125.00€ *
Review
Hepcidin (Hepc) Recombinant, Mouse
Hepcidin (Hepc) Recombinant, Mouse

Item number: 155040.10

Source:, Recombinant Mouse from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q9EQ21, Fragment: Thr24~Thr83 (Accession No: Q9EQ21), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-TYLHQQM RQTTELQPLH GEESRADIAI PMQKRRKRDT NFPICIFCCK CCNNSQCGIC CKT,...
From 399.00€ *
Review
1 from 2 pages