- Search results for Q9EQ21
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
14 products were found matching "Q9EQ21"!
Close filters
Filter by:
No results were found for the filter!
-10 %
Discount Promotion
Item number: ELK-ELK8198.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse Hepc. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse Hepc. Next,...
Keywords: | Hamp, Hamp1, Hepcidin |
Application: | ELISA |
Species reactivity: | mouse |
365.00€
*
From 328.50€
*
Item number: E-EL-M0671.96
The kit is a Sandwich enzyme immunoassay for in vitro quantitative measurement of Hepc in serum, plasma and other biological fluids. Detection Range: 125--8000pg/mL. Sensitivity: 75pg/mL. Protein function: Liver-produced hormone that constitutes the main circulating regulator of iron absorption and distribution...
Keywords: | Hamp, Hamp1, Hepcidin |
Application: | ELISA |
Species reactivity: | mouse |
392.00€
*
Item number: G-MOFI00889.96
Application: | ELISA |
Species reactivity: | mouse |
694.00€
*
Item number: E-CL-M0415.96
Type: Sandwich. Detection Range: 31.25~2000pg/mL. Sensitivity: 18.75pg/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Mouse Hepc . Standards or...
Keywords: | Hamp, Hamp1, Hepcidin |
Application: | CLIA |
Species reactivity: | mouse |
541.00€
*
Item number: G-MOES00365.96
ELISA Type: CLIA. Sensitivity: 18.75 pg/mL. Range: 31.25--2000 pg/mL. Protein function: Liver-produced hormone that constitutes the main circulating regulator of iron absorption and distribution across tissues. Acts by promoting endocytosis and degradation of ferroportin, leading to the retention of iron in...
Keywords: | Hamp, Hamp1, Hepcidin |
Application: | CLIA |
Species reactivity: | mouse |
694.00€
*
Item number: G-MOES01173.96
ELISA Type: Sandwich. Sensitivity: 75pg/mL. Range: 125--8000pg/mL. Protein function: Liver-produced hormone that constitutes the main circulating regulator of iron absorption and distribution across tissues. Acts by promoting endocytosis and degradation of ferroportin, leading to the retention of iron in...
Keywords: | Hamp, Hamp1, Hepcidin |
Application: | Sandwich ELISA |
Species reactivity: | mouse |
534.00€
*
Item number: E-PDEM100034.100
Activity: Testing in progress Protein Construction: A DNA sequence encoding the Mouse Hepc protein (Q9EQ21) (Asp59-Thr83) was expressed with a N terminal His-TRX tag. Sequence: Asp59-Thr83. Fusion tag: N-Trx-His Endotoxin: Please contact us for more information. Apparent Molecular Mass: 25 kDa. Protein function:...
Keywords: | Hamp, Hamp1, Hepcidin, Recombinant Mouse Hepcidin/Hepc protein (TRX,His tag) |
Expressed in: | E.coli |
Origin: | mouse |
MW: | 22.64 kD |
From 81.00€
*
Item number: E-EL-M0671.24
The kit is a Sandwich enzyme immunoassay for in vitro quantitative measurement of Hepc in serum, plasma and other biological fluids. Detection Range: 125--8000pg/mL. Sensitivity: 75pg/mL. Protein function: Liver-produced hormone that constitutes the main circulating regulator of iron absorption and distribution...
Keywords: | Hamp, Hamp1, Hepcidin |
Application: | ELISA |
Species reactivity: | mouse |
From 118.00€
*
Item number: E-CL-M0415.24
Type: Sandwich. Detection Range: 31.25~2000pg/mL. Sensitivity: 18.75pg/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Mouse Hepc . Standards or...
Keywords: | Hamp, Hamp1, Hepcidin |
Application: | CLIA |
Species reactivity: | mouse |
From 142.00€
*
Item number: VMPS-2718
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: | Hamp, Hamp1, Hepcidin |
Application: | RNA quantification |
43.00€
*
Item number: 025650.96
Hepcidin (Hepc) BioAssay(TM) ELISA Kit (Mouse) is a sandwich enzyme immunoassay for in vitro quantitative measurement of Hepc in mouse serum, plasma, urine and other biological fluids. Detection Range: 62.5-4,000pg/ml, Sensitivity: 27.2pg/ml, Storage and Stability: Desiccation recommended. The Standard, Detection...
Keywords: | Hamp, Hamp1, Hepcidin |
Application: | ELISA |
Species reactivity: | mouse |
1,125.00€
*
Item number: 155040.10
Source:, Recombinant Mouse from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q9EQ21, Fragment: Thr24~Thr83 (Accession No: Q9EQ21), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-TYLHQQM RQTTELQPLH GEESRADIAI PMQKRRKRDT NFPICIFCCK CCNNSQCGIC CKT,...
From 399.00€
*