11 products were found matching "Q96S44"!

Protein function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine (PubMed:22912744, PubMed:27903914). The complex is probably involved in the transfer of the threonylcarbamoyl...

Polyclonal Antibody against Human TP53RK, Gene description: TP53 regulating kinase, Alternative Gene Names: BUD32, C20orf64, dJ101A2.2, Nori-2p, prpk, TPRKB, Validated applications: IHC, WB, Uniprot ID: Q96S44, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein...

Protein function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine (PubMed:22912744, PubMed:27903914). The complex is probably involved in the transfer of the threonylcarbamoyl...

Recombinant full-length human TP53RK was expressed by baculovirus in Sf9 insect cells using an N-Terminal Glutathione-S-Transferase fusion protein. The purity was determined to be >80% by densitometry. Protein function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl...

Protein kinase that phosphorylates 'Ser-15' of p53/TP53 protein and may therefore participate in its activation. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid...

Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism,...

Protein function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine (PubMed:22912744, PubMed:27903914). The complex is probably involved in the transfer of the threonylcarbamoyl...

Protein function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine (PubMed:22912744, PubMed:27903914). The complex is probably involved in the transfer of the threonylcarbamoyl...

Length: 762 Sequence: atggcggcgg ccagagctac tacgccggcc gatggcgagg agcccgcccc ggaggctgag gctctggccg cagcccggga gcggagcagc cgcttcttga gcggcctgga gctggtgaag cagggtgccg aggcgcgcgt gttccgtggc cgcttccagg gccgcgcggc ggtgatcaag caccgcttcc ccaagggcta ccggcacccg gcgctggagg cgcggcttgg cagacggcgg acggtgcagg aggcccgggc...

Protein function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine (PubMed:22912744, PubMed:27903914). The complex is probably involved in the transfer of the threonylcarbamoyl...

PrEST Antigen TP53RK, Gene description: TP53 regulating kinase, Alternative Gene Names: BUD32, C20orf64, dJ101A2.2, Nori-2p, prpk, TPRKB, Antigen sequence: FGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...