7 products were found matching "Q96N77"!
No results were found for the filter!
Anti-ZNF641
Item number: ATA-HPA035189.100
Protein function: Transcriptional activator. Activates transcriptional activities of SRE and AP-1. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 73% and to rat: 71%
| Keywords: | Anti-ZNF641, Anti-Zinc finger protein 641 |
| Application: | WB, IHC, ICC, ChIP |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Anti-ZNF641
Item number: ATA-HPA075069.100
Polyclonal Antibody against Human ZNF641, Gene description: zinc finger protein 641, Alternative Gene Names: FLJ31295, Validated applications: ICC, Uniprot ID: Q96N77, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Transcriptional activator. Activates...
| Keywords: | Anti-ZNF641, Anti-Zinc finger protein 641 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
ZNF641 (human), recombinant protein
Item number: ABS-PP-2651-L.100
Protein function: Transcriptional activator. Activates transcriptional activities of SRE and AP-1. [The UniProt Consortium]
| Keywords: | Zinc finger protein 641, Recombinant Human ZNF641 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 15 kD |
From 115.00€
*
ZNF641 PrEST Antigen
Item number: ATA-APrEST83508.100
Protein function: Transcriptional activator. Activates transcriptional activities of SRE and AP-1. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | ZNF641, Zinc finger protein 641 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
ZNF641 (Vector Vector will be determined during the...
Item number: CSB-CL026911HU.10
Length: 909 Sequence: atggcagctg cacttcttgc ggctggatca cagggcctgg taaccatcaa ggatgtgtca ctgtgcttct ctcaggagga gtggcggagc ctggacccct ctcagacaga cttttatgga gaatatgtca tgcaggaaaa ctgtgggata gtagtctctc tgagatttcc aattcccaaa ctggacatgc tttctcaact agaaggagga gaagaacaat gggtccctga cccccaggac ttagaggaga gggacattct...
| Keywords: | ZNF641, Zinc finger protein 641 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
ZNF641 (human), recombinant protein
Item number: ABS-PP-2651.100
Protein function: Transcriptional activator. Activates transcriptional activities of SRE and AP-1. [The UniProt Consortium]
| Keywords: | Zinc finger protein 641, Recombinant Human ZNF641 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 15 kD |
From 90.00€
*
ZNF641 PrEST Antigen
Item number: ATA-APrEST95709.100
PrEST Antigen ZNF641, Gene description: zinc finger protein 641, Alternative Gene Names: FLJ31295, Antigen sequence: DTVLWNPEHDESWDSMPSSSRGMLLGPPFLQEDSFSNLLCSTEMDSLLRPHTCPQCGKQFVW, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Transcriptional activator. Activates...
| Keywords: | ZNF641, Zinc finger protein 641 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*