7 products were found matching "Q96M34"!
No results were found for the filter!
Anti-C3orf30
Item number: ATA-HPA062468.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 40% and to rat: 42%
| Keywords: | Anti-C3orf30, Anti-Testis-specific expressed protein 55, Anti-Testis-specific conserved, cAMP-dependent type II... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 330.00€
*
Anti-TEX55
Item number: ATA-HPA068480.100
Polyclonal Antibody against Human TEX55, Gene description: testis expressed 55, Alternative Gene Names: C3orf30, FLJ32859, TSCPA, Validated applications: ICC, Uniprot ID: Q96M34, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 25% Rat gene identity: 25%
| Keywords: | Anti-C3orf30, Anti-Testis-specific expressed protein 55, Anti-Testis-specific conserved, cAMP-dependent type II... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
TEX55 (human), recombinant protein
Item number: ABS-PP-2645-L.100
| Keywords: | Testis-specific expressed protein 55, Testis-specific conserved, cAMP-dependent type II PK-anchoring protein, Recombinant... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 16 kD |
From 115.00€
*
C3orf30 PrEST Antigen
Item number: ATA-APrEST87967.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | C3orf30, Testis-specific expressed protein 55, Testis-specific conserved, cAMP-dependent type II PK-anchoring protein |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
C3orf30 (Vector pUC, Accession No. BC130475)
Item number: CSB-CL822257HU.10
Length: 1611 Sequence: atggaagagc ctccgcaaga ggctctggct gaacccttga aacatgaaag cccagccgct ccctcaagtg ctggccacac taagggccag gaagaagacg accagaagaa ccaggccgaa aggaaggcag ataaccacac tgctcacaga atagctgacc agactgccct aagagtgcct agccaggctg aatccagcat atttagccaa gctaccaacg gagtagctga acaaaatggg catagtacac ctggtcaggc...
| Keywords: | C3orf30, Testis-specific expressed protein 55, Testis-specific conserved, cAMP-dependent type II PK-anchoring protein |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
592.00€
*
TEX55 (human), recombinant protein
Item number: ABS-PP-2645.100
| Keywords: | Testis-specific expressed protein 55, Testis-specific conserved, cAMP-dependent type II PK-anchoring protein, Recombinant... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 16 kD |
From 90.00€
*
TEX55 PrEST Antigen
Item number: ATA-APrEST95700.100
PrEST Antigen TEX55, Gene description: testis expressed 55, Alternative Gene Names: C3orf30, FLJ32859, TSCPA, Antigen sequence: DYRLAGLADPGTSEQTDLRLYGLVDHKTSVKTHHQVYGQATELAEHQAIDQAHSNADQPPVDNAHYTESDQTDHLADRQAN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 25% Rat...
| Keywords: | C3orf30, Testis-specific expressed protein 55, Testis-specific conserved, cAMP-dependent type II PK-anchoring protein |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*