4 products were found matching "Q96LM9"!
No results were found for the filter!
Anti-C20orf173
Item number: ATA-HPA076859.100
Polyclonal Antibody against Human C20orf173, Gene description: chromosome 20 open reading frame 173, Alternative Gene Names: dJ477O4.4, Validated applications: ICC, Uniprot ID: Q96LM9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 31% Rat gene...
| Keywords: | Anti-C20orf173, Anti-Uncharacterized protein C20orf173 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Anti-CT173, ID (C20orf173, Uncharacterized protein...
Item number: 034312.200
Applications:, Suitable for use in Western Blot, Immunohistochemistry, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Immunohistochemistry: 1:50-100, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are...
| Keywords: | Anti-C20orf173, Anti-Uncharacterized protein C20orf173 |
| Application: | ELISA, IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
Anti-CT173
Item number: ELK-ES17195.100
Recommended dilutions: WB 1:500-2000. Cellular localization: integral component of membrane,
| Keywords: | Anti-C20orf173, Anti- C20orf173, CT173 rabbit pAb |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, rat, mouse, |
From 173.00€
*
C20orf173 PrEST Antigen
Item number: ATA-APrEST96207.100
PrEST Antigen C20orf173, Gene description: chromosome 20 open reading frame 173, Alternative Gene Names: dJ477O4.4, Antigen sequence: VLLGRPQIPQGSSLGNDIDQYPVVFRNASDQGSWMQLEMLLRKLSDLVWTSDALSDKILED, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 31% Rat gene identity: 31%
| Keywords: | C20orf173, Uncharacterized protein C20orf173 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
