8 products were found matching "Q96JJ6"!

No results were found for the filter!
Anti-JPH4
Anti-JPH4

Item number: 600-401-CC9

Anti-JPH4 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. Cross reactivity with JPH4 from other sources has not been determined. Protein function: Junctophilins contribute to the formation of junctional membrane complexes (JMCs) which link the plasma membrane with the...
Keywords: Anti-JP-4, Anti-JPH4, Anti-JPHL1, Anti-Junctophilin-4, Anti-Junctophilin-like 1 protein
Application: ELISA, IHC, IFM, WB
Host: Rabbit
Species reactivity: human, mouse, rat
848.00€ *
Review
Anti-JPH4
Anti-JPH4

Item number: 600-401-CD0

Anti-JPH4 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. Cross reactivity with JPH4 from other sources has not been determined. Protein function: Junctophilins contribute to the formation of junctional membrane complexes (JMCs) which link the plasma membrane with the...
Keywords: Anti-JP-4, Anti-JPH4, Anti-JPHL1, Anti-Junctophilin-4, Anti-Junctophilin-like 1 protein
Application: ELISA, WB
Host: Rabbit
Species reactivity: human, mouse, rat
848.00€ *
Review
Anti-JPH4
Anti-JPH4

Item number: ATA-HPA045022.100

Polyclonal Antibody against Human JPH4, Gene description: junctophilin 4, Alternative Gene Names: JPHL1, KIAA1831, Validated applications: ICC, Uniprot ID: Q96JJ6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Junctophilins contribute to the formation of...
Keywords: Anti-JP-4, Anti-JPH4, Anti-JPHL1, Anti-Junctophilin-4, Anti-Junctophilin-like 1 protein
Application: ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
NEW
Anti-JPH4
Anti-JPH4

Item number: ATA-HPA045022.25

Polyclonal Antibody against Human JPH4, Gene description: junctophilin 4, Alternative Gene Names: JPHL1, KIAA1831, Validated applications: ICC, Uniprot ID: Q96JJ6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Junctophilins contribute to the formation of...
Keywords: Anti-JP-4, Anti-JPH4, Anti-JPHL1, Anti-Junctophilin-4, Anti-Junctophilin-like 1 protein
Application: ICC
Host: Rabbit
Species reactivity: human
361.00€ *
Review
JPH4 (human), recombinant protein
JPH4 (human), recombinant protein

Item number: ABS-PP-24831.100

Protein function: Junctophilins contribute to the formation of junctional membrane complexes (JMCs) which link the plasma membrane with the endoplasmic or sarcoplasmic reticulum in excitable cells. Provides a structural foundation for functional cross-talk between the cell surface and intracellular calcium release...
Keywords: JPH4, JP-4, JPHL1, Junctophilin-4, Junctophilin-like 1 protein
Expressed in: E.coli
Origin: human
MW: 10 kD
From 90.00€ *
Review
JPH4 (human), recombinant protein
JPH4 (human), recombinant protein

Item number: ABS-PP-24831-L.100

Protein function: Junctophilins contribute to the formation of junctional membrane complexes (JMCs) which link the plasma membrane with the endoplasmic or sarcoplasmic reticulum in excitable cells. Provides a structural foundation for functional cross-talk between the cell surface and intracellular calcium release...
Keywords: JPH4, JP-4, JPHL1, Junctophilin-4, Junctophilin-like 1 protein
Expressed in: E.coli
Origin: human
MW: 10 kD
From 115.00€ *
Review
JPHL1, Human, Real Time PCR Primer Set
JPHL1, Human, Real Time PCR Primer Set

Item number: VHPS-4706

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: JPH4, JP-4, JPHL1, Junctophilin-4, Junctophilin-like 1 protein
Application: RNA quantification
45.00€ *
Review
JPH4 PrEST Antigen
JPH4 PrEST Antigen

Item number: ATA-APrEST95836.100

PrEST Antigen JPH4, Gene description: junctophilin 4, Alternative Gene Names: JPHL1, KIAA1831, Antigen sequence: PSSPASSRQPWRPPACRSPLPPGGDQGPFSSPKAWPEEWGGAGAQAEELAGYEAEDEAGMQGPGPRDGSPLLGGCSDSSGSLREEE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Junctophilins contribute...
Keywords: JPH4, JP-4, JPHL1, Junctophilin-4, Junctophilin-like 1 protein
Expressed in: E.coli
Origin: human
264.00€ *
Review