17 products were found matching "Q969Q0"!
No results were found for the filter!
Anti-RPL36AL
Item number: ARG40081.100
| Keywords: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
707.00€
*
60S ribosomal protein L36a-like (RPL36AL), human,...
Item number: CSB-RP018044h.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-106aa. Protein Length: Full Length. Tag Info: N-terminal GST-tagged. Target Protein Sequence: MVNVPKTRRT FCKKCGKHQP HKVTQYKKGK DSLYAQGRRR YDRKQSGYGG QTKPIFRKKA KTTKKIVLRL ECVEPNCRSK RMLAIKRCKH FELGGDKKRK GQVIQF. Purity: Greater than 90% as...
| Keywords: | RPL36AL, 60S ribosomal protein L36a-like, Large ribosomal subunit protein eL42-like, Recombinant Human 60S ribosomal... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 39.5 kD |
From 219.00€
*
Anti-RPL36AL
Item number: CSB-PA01804A0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
| Keywords: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-RPL36AL
Item number: CSB-PA01805A0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
| Keywords: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-RPL36AL
Item number: E-AB-64989.120
Cytoplasmic ribosomes, organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The...
| Keywords: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL Polyclonal... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 243.00€
*
RPL36AL, Recombinant, Human, aa1-106, GST-Tag (60S...
Item number: 375106.1
Belongs to the ribosomal protein L44e family. Source: Recombinant protein corresponding to aa1-106 from RPL36AL, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.5kD, AA Sequence: MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF,...
| Keywords: | RPL36AL, 60S ribosomal protein L36a-like, Large ribosomal subunit protein eL42-like |
| MW: | 39,5 |
From 603.00€
*
Anti-RPL36AL
Item number: G-CAB14366.100
WB 1:500 - 1:2000.
| Keywords: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL Polyclonal... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 103.00€
*
Anti-RL36L
Item number: ELK-ES9327.100
Cytoplasmic ribosomes, organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The...
| Keywords: | Anti-RPL36AL, Anti-Ribosomal protein eL42-like, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein... |
| Application: | WB, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, rat, mouse, |
From 173.00€
*
Anti-RPL36AL, HRP conjugated
Item number: CSB-PA01804B0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
| Keywords: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-RPL36AL, FITC conjugated
Item number: CSB-PA01804C0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
| Keywords: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-RPL36AL, Biotin conjugated
Item number: CSB-PA01804D0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
| Keywords: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-RPL36AL, HRP conjugated
Item number: CSB-PA01805B0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
| Keywords: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*