16 products were found matching "Q969Q0"!

1 from 2 pages
No results were found for the filter!
Anti-RPL36AL
Anti-RPL36AL

Item number: ARG40081.100

Keywords: Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like
Application: WB
Host: Rabbit
Species reactivity: human, mouse
707.00€ *
Review
60S ribosomal protein L36a-like (RPL36AL), human, recombinant
60S ribosomal protein L36a-like (RPL36AL), human,...

Item number: CSB-RP018044h.1

Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-106aa. Protein Length: Full Length. Tag Info: N-terminal GST-tagged. Target Protein Sequence: MVNVPKTRRT FCKKCGKHQP HKVTQYKKGK DSLYAQGRRR YDRKQSGYGG QTKPIFRKKA KTTKKIVLRL ECVEPNCRSK RMLAIKRCKH FELGGDKKRK GQVIQF. Purity: Greater than 90% as...
Keywords: RPL36AL, 60S ribosomal protein L36a-like, Large ribosomal subunit protein eL42-like, Recombinant Human 60S ribosomal...
Application: Activity not tested
Expressed in: E.coli
Origin: human
MW: 39.5 kD
From 219.00€ *
Review
Anti-RPL36AL
Anti-RPL36AL

Item number: CSB-PA01804A0Rb.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
Keywords: Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S...
Application: ELISA, WB
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Anti-RPL36AL
Anti-RPL36AL

Item number: CSB-PA01805A0Rb.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
Keywords: Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S...
Application: ELISA, WB
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
RPL36AL (human), recombinant protein
RPL36AL (human), recombinant protein

Item number: ABS-PP-10782-L.100

Keywords: Ribosomal protein eL42-like, 60S ribosomal protein L36a-like, Large ribosomal subunit protein eL42-like, Recombinant Human...
Expressed in: E.coli
Origin: human
MW: 13 kD
From 115.00€ *
Review
RPL36AL, Recombinant, Human, aa1-106, GST-Tag (60S Ribosomal Protein L36a-like)
RPL36AL, Recombinant, Human, aa1-106, GST-Tag (60S...

Item number: 375106.1

Belongs to the ribosomal protein L44e family. Source: Recombinant protein corresponding to aa1-106 from RPL36AL, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.5kD, AA Sequence: MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF,...
Keywords: RPL36AL, 60S ribosomal protein L36a-like, Large ribosomal subunit protein eL42-like
MW: 39,5
From 603.00€ *
Review
Anti-RPL36AL
Anti-RPL36AL

Item number: G-CAB14366.20

RPL36AL Rabbit Polyclonal Antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in WB IF applications.RPL36AL Rabbit Polyclonal Antibody is an IgG isotype antibody and produced in Rabbit and purified by Affinity purification from Assay Genie.
Keywords: Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like
Application: WB, IF
Host: Rabbit
Species reactivity: human, mouse, rat
103.00€ *
Review
Anti-RL36L
Anti-RL36L

Item number: ELK-ES9327.100

Cytoplasmic ribosomes, organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The...
Keywords: Anti-RPL36AL, Anti-Ribosomal protein eL42-like, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein...
Application: WB, ELISA
Host: Rabbit
Species reactivity: human, rat, mouse,
From 173.00€ *
Review
Anti-RPL36AL, HRP conjugated
Anti-RPL36AL, HRP conjugated

Item number: CSB-PA01804B0Rb.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
Keywords: Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S...
Application: ELISA
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Anti-RPL36AL, FITC conjugated
Anti-RPL36AL, FITC conjugated

Item number: CSB-PA01804C0Rb.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
Keywords: Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S...
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Anti-RPL36AL, Biotin conjugated
Anti-RPL36AL, Biotin conjugated

Item number: CSB-PA01804D0Rb.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
Keywords: Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S...
Application: ELISA
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Anti-RPL36AL, HRP conjugated
Anti-RPL36AL, HRP conjugated

Item number: CSB-PA01805B0Rb.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
Keywords: Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S...
Application: ELISA
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
1 from 2 pages