- Search results for Q8TDW7
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
13 products were found matching "Q8TDW7"!
Close filters
Filter by:
No results were found for the filter!
Item number: CSB-PA068600.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: FAT3. Antigen Species: Human
| Keywords: | Anti-FAT3, Anti-hFat3, Anti-CDHF15, Anti-Protocadherin Fat 3, Anti-Cadherin family member 15, Anti-FAT tumor suppressor... |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 167.00€
*
Item number: CSB-PA983024.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: FAT3. Antigen Species: Human
| Keywords: | Anti-FAT3, Anti-hFat3, Anti-CDHF15, Anti-Protocadherin Fat 3, Anti-Cadherin family member 15, Anti-FAT tumor suppressor... |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 167.00€
*
Item number: ATA-HPA074824.100
Polyclonal Antibody against Human FAT3, Gene description: FAT atypical cadherin 3, Alternative Gene Names: CDHF15, CDHR10, KIAA1989, Validated applications: ICC, Uniprot ID: Q8TDW7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May play a role in the...
| Keywords: | Anti-FAT3, Anti-hFat3, Anti-CDHF15, Anti-Protocadherin Fat 3, Anti-Cadherin family member 15, Anti-FAT tumor suppressor... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ATA-HPA074824.25
Polyclonal Antibody against Human FAT3, Gene description: FAT atypical cadherin 3, Alternative Gene Names: CDHF15, CDHR10, KIAA1989, Validated applications: ICC, Uniprot ID: Q8TDW7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May play a role in the...
| Keywords: | Anti-FAT3, Anti-hFat3, Anti-CDHF15, Anti-Protocadherin Fat 3, Anti-Cadherin family member 15, Anti-FAT tumor suppressor... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Item number: 315751.100
FAT1, FAT2, FAT3 and FAT4 are human homologs of Drosophila Fat, which is involved in tumor suppression and planar cell polarity (PCP). The atypical cadherin Fat3 ensures that retinal amacrine cells (ACs) develop this unipolar morphology. Fat3 expression was restricted to the nervous system, for example in the brain,...
| Keywords: | Anti-FAT3, Anti-hFat3, Anti-CDHF15, Anti-Protocadherin Fat 3, Anti-Cadherin family member 15, Anti-FAT tumor suppressor... |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 571.00€
*
Item number: 315752.100
FAT1, FAT2, FAT3 and FAT4 are human homologs of Drosophila Fat, which is involved in tumor suppression and planar cell polarity (PCP). The atypical cadherin Fat3 ensures that retinal amacrine cells (ACs) develop this unipolar morphology. Fat3 expression was restricted to the nervous system, for example in the brain,...
| Keywords: | Anti-FAT3, Anti-hFat3, Anti-CDHF15, Anti-Protocadherin Fat 3, Anti-Cadherin family member 15, Anti-FAT tumor suppressor... |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 571.00€
*
Item number: CSB-PA819472LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: FAT3. Antigen Species: Human
| Keywords: | Anti-FAT3, Anti-hFat3, Anti-CDHF15, Anti-Protocadherin Fat 3, Anti-Cadherin family member 15, Anti-FAT tumor suppressor... |
| Application: | ELISA, IHC, IF |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA819472LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: FAT3. Antigen Species: Human
| Keywords: | Anti-FAT3, Anti-hFat3, Anti-CDHF15, Anti-Protocadherin Fat 3, Anti-Cadherin family member 15, Anti-FAT tumor suppressor... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA819472LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: FAT3. Antigen Species: Human
| Keywords: | Anti-FAT3, Anti-hFat3, Anti-CDHF15, Anti-Protocadherin Fat 3, Anti-Cadherin family member 15, Anti-FAT tumor suppressor... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA819472LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: FAT3. Antigen Species: Human
| Keywords: | Anti-FAT3, Anti-hFat3, Anti-CDHF15, Anti-Protocadherin Fat 3, Anti-Cadherin family member 15, Anti-FAT tumor suppressor... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: ABS-PP-2553.100
Protein function: May play a role in the interactions between neurites derived from specific subsets of neurons during development. [The UniProt Consortium]
| Keywords: | Protocadherin Fat 3, hFat3, Cadherin family member 15, FAT tumor suppressor homolog 3, Recombinant Human FAT3 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 20 kD |
From 90.00€
*
Item number: ATA-APrEST96175.100
PrEST Antigen FAT3, Gene description: FAT atypical cadherin 3, Alternative Gene Names: CDHF15, CDHR10, KIAA1989, Antigen sequence: PSFTQSQYSFTIAEDTAIGSTVDTLRILPSQNVWFSTVNGERPENNKGGVFVIEQETGTIKLDKRLDRETSPAFHFKVAATIPLDKVDIVFTVDV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Keywords: | FAT3, hFat3, CDHF15, Protocadherin Fat 3, Cadherin family member 15, FAT tumor suppressor homolog 3 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*