13 products were found matching "Q8TDW7"!

1 from 2 pages
No results were found for the filter!
Anti-FAT3
Anti-FAT3

Item number: CSB-PA068600.100

Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: FAT3. Antigen Species: Human
Keywords: Anti-FAT3, Anti-hFat3, Anti-CDHF15, Anti-Protocadherin Fat 3, Anti-Cadherin family member 15, Anti-FAT tumor suppressor...
Application: ELISA, IHC
Host: Rabbit
Species reactivity: human, mouse, rat
From 167.00€ *
Review
Anti-FAT3
Anti-FAT3

Item number: CSB-PA983024.100

Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: FAT3. Antigen Species: Human
Keywords: Anti-FAT3, Anti-hFat3, Anti-CDHF15, Anti-Protocadherin Fat 3, Anti-Cadherin family member 15, Anti-FAT tumor suppressor...
Application: ELISA, IHC
Host: Rabbit
Species reactivity: human, mouse, rat
From 167.00€ *
Review
Anti-FAT3
Anti-FAT3

Item number: ATA-HPA074824.100

Polyclonal Antibody against Human FAT3, Gene description: FAT atypical cadherin 3, Alternative Gene Names: CDHF15, CDHR10, KIAA1989, Validated applications: ICC, Uniprot ID: Q8TDW7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May play a role in the...
Keywords: Anti-FAT3, Anti-hFat3, Anti-CDHF15, Anti-Protocadherin Fat 3, Anti-Cadherin family member 15, Anti-FAT tumor suppressor...
Application: ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
Anti-FAT3
Anti-FAT3

Item number: ATA-HPA074824.25

Polyclonal Antibody against Human FAT3, Gene description: FAT atypical cadherin 3, Alternative Gene Names: CDHF15, CDHR10, KIAA1989, Validated applications: ICC, Uniprot ID: Q8TDW7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May play a role in the...
Keywords: Anti-FAT3, Anti-hFat3, Anti-CDHF15, Anti-Protocadherin Fat 3, Anti-Cadherin family member 15, Anti-FAT tumor suppressor...
Application: ICC
Host: Rabbit
Species reactivity: human
361.00€ *
Review
Anti-FAT3
Anti-FAT3

Item number: 315751.100

FAT1, FAT2, FAT3 and FAT4 are human homologs of Drosophila Fat, which is involved in tumor suppression and planar cell polarity (PCP). The atypical cadherin Fat3 ensures that retinal amacrine cells (ACs) develop this unipolar morphology. Fat3 expression was restricted to the nervous system, for example in the brain,...
Keywords: Anti-FAT3, Anti-hFat3, Anti-CDHF15, Anti-Protocadherin Fat 3, Anti-Cadherin family member 15, Anti-FAT tumor suppressor...
Application: ELISA, IHC
Host: Rabbit
Species reactivity: human, mouse, rat
From 571.00€ *
Review
Anti-FAT3
Anti-FAT3

Item number: 315752.100

FAT1, FAT2, FAT3 and FAT4 are human homologs of Drosophila Fat, which is involved in tumor suppression and planar cell polarity (PCP). The atypical cadherin Fat3 ensures that retinal amacrine cells (ACs) develop this unipolar morphology. Fat3 expression was restricted to the nervous system, for example in the brain,...
Keywords: Anti-FAT3, Anti-hFat3, Anti-CDHF15, Anti-Protocadherin Fat 3, Anti-Cadherin family member 15, Anti-FAT tumor suppressor...
Application: ELISA, IHC
Host: Rabbit
Species reactivity: human, mouse, rat
From 571.00€ *
Review
Anti-FAT3
Anti-FAT3

Item number: CSB-PA819472LA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: FAT3. Antigen Species: Human
Keywords: Anti-FAT3, Anti-hFat3, Anti-CDHF15, Anti-Protocadherin Fat 3, Anti-Cadherin family member 15, Anti-FAT tumor suppressor...
Application: ELISA, IHC, IF
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Anti-FAT3, HRP conjugated
Anti-FAT3, HRP conjugated

Item number: CSB-PA819472LB01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: FAT3. Antigen Species: Human
Keywords: Anti-FAT3, Anti-hFat3, Anti-CDHF15, Anti-Protocadherin Fat 3, Anti-Cadherin family member 15, Anti-FAT tumor suppressor...
Application: ELISA
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Anti-FAT3, FITC conjugated
Anti-FAT3, FITC conjugated

Item number: CSB-PA819472LC01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: FAT3. Antigen Species: Human
Keywords: Anti-FAT3, Anti-hFat3, Anti-CDHF15, Anti-Protocadherin Fat 3, Anti-Cadherin family member 15, Anti-FAT tumor suppressor...
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Anti-FAT3, Biotin conjugated
Anti-FAT3, Biotin conjugated

Item number: CSB-PA819472LD01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: FAT3. Antigen Species: Human
Keywords: Anti-FAT3, Anti-hFat3, Anti-CDHF15, Anti-Protocadherin Fat 3, Anti-Cadherin family member 15, Anti-FAT tumor suppressor...
Application: ELISA
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
FAT3 (human), recombinant protein
FAT3 (human), recombinant protein

Item number: ABS-PP-2553.100

Protein function: May play a role in the interactions between neurites derived from specific subsets of neurons during development. [The UniProt Consortium]
Keywords: Protocadherin Fat 3, hFat3, Cadherin family member 15, FAT tumor suppressor homolog 3, Recombinant Human FAT3 Protein
Expressed in: E.coli
Origin: human
MW: 20 kD
From 90.00€ *
Review
FAT3 PrEST Antigen
FAT3 PrEST Antigen

Item number: ATA-APrEST96175.100

PrEST Antigen FAT3, Gene description: FAT atypical cadherin 3, Alternative Gene Names: CDHF15, CDHR10, KIAA1989, Antigen sequence: PSFTQSQYSFTIAEDTAIGSTVDTLRILPSQNVWFSTVNGERPENNKGGVFVIEQETGTIKLDKRLDRETSPAFHFKVAATIPLDKVDIVFTVDV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
Keywords: FAT3, hFat3, CDHF15, Protocadherin Fat 3, Cadherin family member 15, FAT tumor suppressor homolog 3
Expressed in: E.coli
Origin: human
264.00€ *
Review
1 from 2 pages