- Search results for Q8NHS3
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
11 products were found matching "Q8NHS3"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA044802.100
Protein function: May be a carrier that transport small solutes by using chemiosmotic ion gradients. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 66% and to rat: 66%
| Keywords: | Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing... |
| Application: | IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 330.00€
*
Item number: G-PACO39166.50
MFSD8 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC, IF applications. MFSD8 Antibody is a high quality polyclonal antibody for research use only.. Protein function: May be a carrier that transport small solutes by using chemiosmotic ion gradients. [The...
| Keywords: | Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing... |
| Application: | ELISA, IHC, IF |
| Host: | Rabbit |
| Species reactivity: | human |
313.00€
*
Item number: CSB-EP844087HU1.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-40aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-GST-tagged. Target Protein Sequence: MAGLRNESEQ EPLLGDTPGS REWDILETEE HYKSRWRSIR. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin: Not test. Biological Activity: n/a. Form:...
| Keywords: | CLN7, MFSD8, Ceroid-lipofuscinosis neuronal protein 7, Major facilitator superfamily domain-containing protein 8,... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 34.8 kD |
From 292.00€
*
Item number: 374200.100
May be a carrier that transport small solutes by using chemiosmotic ion gradients. Source: Recombinant protein corresponding to aa1-40 from human MFSD8, fused to His-GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~34.8kD, AA Sequence: MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWRSIR, Storage and Stability:...
| Keywords: | CLN7, MFSD8, Ceroid-lipofuscinosis neuronal protein 7, Major facilitator superfamily domain-containing protein 8 |
| MW: | 34,8 |
From 690.00€
*
Item number: ATA-APrEST84093.100
Protein function: May be a carrier that transport small solutes by using chemiosmotic ion gradients. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | CLN7, MFSD8, Ceroid-lipofuscinosis neuronal protein 7, Major facilitator superfamily domain-containing protein 8 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ELK-ES11413.100
This gene encodes a ubiquitous integral membrane protein that contains a transporter domain and a major facilitator superfamily (MFS) domain. Other members of the major facilitator superfamily transport small solutes through chemiosmotic ion gradients. The substrate transported by this protein is unknown. The...
| Keywords: | Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing protein 8, MFSD8... |
| Application: | WB, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, rat, mouse, |
From 173.00€
*
Item number: CSB-CL844087HU.10
Length: 1557 Sequence: atggccggcc tgcggaacga aagtgaacag gagccgctct taggcgacac acctggaagc agagaatggg acattttaga gactgaagag cattataaga gccgatggag atctattagg attttatatc ttactatgtt tctcagcagt gtagggtttt ctgtagtgat gatgtccata tggccatatc tccaaaagat tgatccgaca gctgatacaa gttttttggg ctgggttatt gcttcatata gtcttggcca...
| Keywords: | CLN7, MFSD8, Ceroid-lipofuscinosis neuronal protein 7, Major facilitator superfamily domain-containing protein 8 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
357.00€
*
Item number: CSB-PA844087LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MFSD8. Antigen Species: Human
| Keywords: | Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing... |
| Application: | ELISA, IHC, IF |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA844087LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MFSD8. Antigen Species: Human
| Keywords: | Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA844087LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MFSD8. Antigen Species: Human
| Keywords: | Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA844087LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MFSD8. Antigen Species: Human
| Keywords: | Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*