12 products were found matching "Q8NES8"!

No results were found for the filter!
NEW
Human DEFb124 (Defensin Beta 124) Microsample ELISA Kit
Human DEFb124 (Defensin Beta 124) Microsample ELISA Kit

Item number: ELK-ELK6684MS.48

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human DEFb124. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human DEFb124....
Keywords: DEFB124, Beta-defensin 24, Beta-defensin 124, Defensin, beta 124
Application: ELISA
Species reactivity: human
From 374.00€ *
Review
DEFB124 Protein, Human, Recombinant (His)
DEFB124 Protein, Human, Recombinant (His)

Item number: TGM-TMPH-03815-100ug

Description: DEFB124 Protein, Human, Recombinant (His) is expressed in P. pastoris (Yeast) with N-6xHis. The accession number is Q8NES8.
Keywords: Beta-defensin 24 (DEFB-24) , DEFB24 , Beta-defensin 124 , Defensin, beta 124 , DEFB124
MW: 7.7 kD
From 80.00€ *
Review
Anti-DEFB124
Anti-DEFB124

Item number: ATA-HPA051046.100

Protein function: Has antibacterial activity. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 69% and to rat: 69%
Keywords: Anti-DEFB24, Anti-DEFB124, Anti-DEFB-24, Anti-Beta-defensin 24, Anti-Beta-defensin 124, Anti-Defensin, beta 124
Application: IHC
Host: Rabbit
Species reactivity: human
From 369.00€ *
Review
Human DEFb124 (Defensin Beta 124) ELISA Kit
Human DEFb124 (Defensin Beta 124) ELISA Kit

Item number: ELK-ELK6684.48

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human DEFb124. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human DEFb124....
Keywords: DEFB24, DEFB-24, DEFB124, Beta-defensin 24, Beta-defensin 124, Defensin, beta 124
Application: ELISA
Species reactivity: human
From 374.00€ *
Review
Beta-defensin 124 (DEFB124), human, recombinant
Beta-defensin 124 (DEFB124), human, recombinant

Item number: CSB-YP836731HU.1

Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 23-71aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: EFKRCWKGQG ACQTYCTRQE TYMHLCPDAS LCCLSYALKP PPVPKHEYE. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin: Not test....
Keywords: DEFB24, DEFB-24, DEFB124, Beta-defensin 24, Beta-defensin 124, Defensin, beta 124, Recombinant Human Beta-defensin 124...
Application: Activity not tested
Expressed in: Yeast
Origin: human
MW: 7.7 kD
From 242.00€ *
Review
Beta-defensin 124 (DEFB124), human, recombinant
Beta-defensin 124 (DEFB124), human, recombinant

Item number: CSB-EP836731HU.1

Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 23-71aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: EFKRCWKGQG ACQTYCTRQE TYMHLCPDAS LCCLSYALKP PPVPKHEYE. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin: Not test....
Keywords: DEFB24, DEFB-24, DEFB124, Beta-defensin 24, Beta-defensin 124, Defensin, beta 124, Recombinant Human Beta-defensin 124...
Application: Activity not tested
Expressed in: E.coli
Origin: human
MW: 21.7 kD
From 219.00€ *
Review
Human DEFb124 (Defensin Beta 124) ELISA (Small Sample Volume)
Human DEFb124 (Defensin Beta 124) ELISA (Small Sample...

Item number: G-AEKE09992.96

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human DEFb124. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human DEFb124....
Keywords: DEFB124, Beta-defensin 24, Beta-defensin 124, Defensin, beta 124
Application: ELISA
Species reactivity: mouse
694.00€ *
Review
Anti-DEFB124
Anti-DEFB124

Item number: CSB-PA836731ZA01HU.100

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
Keywords: Anti-DEFB24, Anti-DEFB124, Anti-DEFB-24, Anti-Beta-defensin 24, Anti-Beta-defensin 124, Anti-Defensin, beta 124, DEFB124...
Application: ELISA, WB
Host: Rabbit
Species reactivity: Homo sapiens (Human)
From 1,529.00€ *
Review
Defensin Beta 124 (DEFb124) BioAssay(TM) ELISA Kit (Human)
Defensin Beta 124 (DEFb124) BioAssay(TM) ELISA Kit (Human)

Item number: 152486.96

Defensin Beta 124 (DEFb124) BioAssay(TM) ELISA Kit (Human) is a Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Defensin Beta 124 (DEFb124). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated...
Keywords: DEFB24, DEFB124, DEFB-24, Beta-defensin 24, Beta-defensin 124, Defensin, beta 124
Application: ELISA
Species reactivity: human
1,192.00€ *
Review
DEFB124, Recombinant, Human, aa23-71, His-SUMO-Tag (Beta-defensin 124)
DEFB124, Recombinant, Human, aa23-71, His-SUMO-Tag...

Item number: 373026.1

Has antibacterial activity. Curated. Source: Recombinant protein corresponding to aa23-71 from human DEFB124, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~21.7kD, AA Sequence: EFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEYE, Storage and Stability: May be stored at 4°C for...
Keywords: DEFB24, DEFB124, DEFB-24, Beta-defensin 24, Beta-defensin 124, Defensin, beta 124
MW: 21,7
From 603.00€ *
Review
DEFB124 PrEST Antigen
DEFB124 PrEST Antigen

Item number: ATA-APrEST83157.100

Protein function: Has antibacterial activity. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
Keywords: DEFB24, DEFB124, DEFB-24, Beta-defensin 24, Beta-defensin 124, Defensin, beta 124
Application: Control antigen
Expressed in: E.coli
Origin: human
264.00€ *
Review
DEFB124, Recombinant, Human, aa23-71, His-Tag (Beta-defensin 124)
DEFB124, Recombinant, Human, aa23-71, His-Tag...

Item number: 373027.100

Has antibacterial activity. Curated. Source: Recombinant protein corresponding to aa23-71 from human DEFB124, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~7.7kD, AA Sequence: EFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEYE, Storage and Stability: May be stored at 4°C for short-term only....
Keywords: DEFB24, DEFB124, DEFB-24, Beta-defensin 24, Beta-defensin 124, Defensin, beta 124
MW: 7,7
From 557.00€ *
Review