7 products were found matching "Q8NC44"!
No results were found for the filter!
Anti-RETREG2
Item number: ATA-HPA075910.100
Polyclonal Antibody against Human RETREG2, Gene description: reticulophagy regulator family member 2, Alternative Gene Names: C2orf17, FAM134A, MAG-2, MGC3035, Validated applications: IHC, Uniprot ID: Q8NC44, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene...
| Keywords: | Anti-C2orf17, Anti-Reticulophagy regulator 2 |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
477.00€
*
Anti-FAM134A
Item number: A305-800A-T
| Keywords: | Anti-C2orf17, Anti-Reticulophagy regulator 2 |
| Application: | IP |
| Host: | Rabbit |
| Species reactivity: | human |
From 178.00€
*
Anti-FAM134A
Item number: A305-801A
| Keywords: | Anti-C2orf17, Anti-Reticulophagy regulator 2 |
| Application: | WB, IP |
| Host: | Rabbit |
| Species reactivity: | human |
From 178.00€
*
Anti-FAM134A
Item number: ATA-HPA011170.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 77% and to rat: 80%
| Keywords: | Anti-C2orf17, Anti-Reticulophagy regulator 2 |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 320.00€
*
RETREG2 PrEST Antigen
Item number: ATA-APrEST95680.100
PrEST Antigen RETREG2, Gene description: reticulophagy regulator family member 2, Alternative Gene Names: C2orf17, FAM134A, MAG-2, MGC3035, Antigen sequence: LIQRMYTRLEPLLMQLDYSMKAEANALHHKHDKRKRQGKNAPPGGDEPLAETES, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 94% Rat...
| Keywords: | C2orf17, Reticulophagy regulator 2 |
| Expressed in: | E.coli |
| Origin: | human |
265.00€
*
FAM134A, Human family with sequence similarity 134,...
Item number: VHPS-3145
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | C2orf17, FAM134A, Protein FAM134A |
| Application: | RNA quantification |
44.00€
*
FAM134A PrEST Antigen
Item number: ATA-APrEST72046.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | C2orf17, Reticulophagy regulator 2 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
265.00€
*