- Search results for Q8N693
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
12 products were found matching "Q8N693"!
Close filters
Filter by:
No results were found for the filter!
Item number: 600-401-BC1
Anti-ESX1 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. Cross reactivity with ESX1 from other sources has not been determined. Protein function: May coordinately regulate cell cycle progression and transcription during spermatogenesis. Inhibits degradation of...
| Keywords: | Anti-ESX1, Anti-ESX1L |
| Application: | ELISA, IHC, IFM, WB |
| Host: | Rabbit |
| Species reactivity: | human |
848.00€
*
Item number: ATA-HPA051992.100
Protein function: May coordinately regulate cell cycle progression and transcription during spermatogenesis. Inhibits degradation of polyubiquitinated cyclin A and cyclin B1 and thereby arrests the cell cycle at early M phase. ESXR1-N acts as a transcriptional repressor. Binds to the sequence 5'-TAATGTTATTA-3' which...
| Keywords: | Anti-ESX1, Anti-ESX1L |
| Application: | ICC, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Item number: ATA-HPA073330.100
Polyclonal Antibody against Human ESX1, Gene description: ESX homeobox 1, Alternative Gene Names: ESX1L, ESXR1, Validated applications: IHC, Uniprot ID: Q8N693, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May coordinately regulate cell cycle progression...
| Keywords: | Anti-ESX1, Anti-ESX1L |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
NEW
Item number: ATA-HPA073330.25
Polyclonal Antibody against Human ESX1, Gene description: ESX homeobox 1, Alternative Gene Names: ESX1L, ESXR1, Validated applications: IHC, Uniprot ID: Q8N693, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May coordinately regulate cell cycle progression...
| Keywords: | Anti-ESX1, Anti-ESX1L |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Item number: G-PACO09149.100
ESX1 Antibody is a premium polyclonal that offers outstanding performance and reliability for demanding research applications. Rigorously validated for ELISA, WB, this antibody ensures consistent, reproducible results across multiple experimental platforms. Demonstrates excellent reactivity with Human, Mouse...
| Keywords: | Anti-ESX1, Anti-Homeobox protein ESX1, Anti-Extraembryonic, spermatogenesis, homeobox 1 |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
1,124.00€
*
Item number: ABS-PP-10621-L.100
Protein function: May coordinately regulate cell cycle progression and transcription during spermatogenesis. Inhibits degradation of polyubiquitinated cyclin A and cyclin B1 and thereby arrests the cell cycle at early M phase. ESXR1-N acts as a transcriptional repressor. Binds to the sequence 5'-TAATGTTATTA-3' which...
| Keywords: | Homeobox protein ESX1, Extraembryonic, spermatogenesis, homeobox 1) [Cleaved into: Homeobox protein ESX1-N, Homeobox... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 15 kD |
From 115.00€
*
Item number: 035244.200
This gene encodes a dual-function 65 kDa protein that undergoes proteolytic cleavage to produce a 45 kDa N-terminal fragment with a paired-like homeodomain and a 20 kDa C-terminal fragment with a proline-rich domain. The C-terminal fragment localizes to the cytoplasm while the N-terminal fragment localizes...
| Keywords: | Anti-ESX1, Anti-ESX1L |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
Item number: ATA-APrEST83912.100
Protein function: May coordinately regulate cell cycle progression and transcription during spermatogenesis. Inhibits degradation of polyubiquitinated cyclin A and cyclin B1 and thereby arrests the cell cycle at early M phase. ESXR1-N acts as a transcriptional repressor. Binds to the sequence 5'-TAATGTTATTA-3' which...
| Keywords: | ESX1, ESX1L |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ELK-ES16662.100
This gene encodes a dual-function 65 kDa protein that undergoes proteolytic cleavage to produce a 45 kDa N-terminal fragment with a paired-like homeodomain and a 20 kDa C-terminal fragment with a proline-rich domain. The C-terminal fragment localizes to the cytoplasm while the N-terminal fragment localizes...
| Keywords: | Anti-ESX1, Anti-ESX1L, ESX1 rabbit pAb |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, rat, mouse, |
From 173.00€
*
Item number: CSB-PA007838GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: ESX1. Antigen Species: Human
| Keywords: | Anti-ESX1, Anti-ESX1L, ESX1 antibody, ESX1L antibody, ESX1R antibody, Homeobox protein ESX1 antibody, Extraembryonic... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
552.00€
*
Item number: ABS-PP-10621.100
Protein function: May coordinately regulate cell cycle progression and transcription during spermatogenesis. Inhibits degradation of polyubiquitinated cyclin A and cyclin B1 and thereby arrests the cell cycle at early M phase. ESXR1-N acts as a transcriptional repressor. Binds to the sequence 5'-TAATGTTATTA-3' which...
| Keywords: | Homeobox protein ESX1, Extraembryonic, spermatogenesis, homeobox 1) [Cleaved into: Homeobox protein ESX1-N, Homeobox... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 15 kD |
From 90.00€
*
Item number: ATA-APrEST96154.100
PrEST Antigen ESX1, Gene description: ESX homeobox 1, Alternative Gene Names: ESX1L, ESXR1, Antigen sequence: MESLRGYTHSDIGYRSLAVGEDIEEVNDEKLTVTSLMARGGEDEENTRSKPEYGTEAENNVGTEGSVPSDDQDR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May coordinately regulate cell cycle...
| Keywords: | ESX1, ESX1L |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*