- Search results for Q8N5C7
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
18 products were found matching "Q8N5C7"!
Close filters
Filter by:
No results were found for the filter!
Item number: G-PACO26353.50
DTWD1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC, IF applications. DTWD1 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Catalyzes the formation of 3-(3-amino-3-carboxypropyl)uridine (acp3U) at position 20 in...
| Keywords: | Anti-DTW domain-containing protein 1, Anti-tRNA-uridine aminocarboxypropyltransferase 1 |
| Application: | ELISA, IHC, IF |
| Host: | Rabbit |
| Species reactivity: | human |
313.00€
*
Item number: ATA-HPA042214.100
Protein function: Catalyzes the formation of 3-(3-amino-3-carboxypropyl)uridine (acp3U) at position 20 in the D-loop of several cytoplasmic tRNAs (acp3U(20)). [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 87%...
| Keywords: | Anti-DTW domain-containing protein 1, Anti-tRNA-uridine aminocarboxypropyltransferase 1 |
| Application: | ICC, IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Item number: CSB-EP007219HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-109aa. Protein Length: Partial. Tag Info: N-terminal GST-tagged. Target Protein Sequence: MSLNPPIFLK RSEENSSKFV ETKQSQTTSI ASEDPLQNLC LASQEVLQKA QQSGRSKCLK CGGSRMFYCY TCYVPVENVP IEQIPLVKLP LKIDIIKHPN ETDGKSTAI. Purity: Greater than 90% as...
| Keywords: | DTW domain-containing protein 1, tRNA-uridine aminocarboxypropyltransferase 1, Recombinant Human DTW domain-containing... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 39.2 kD |
From 219.00€
*
Item number: VHPS-5634
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | DTWD1, MDS009, DTW domain-containing protein 1 |
| Application: | RNA quantification |
45.00€
*
Item number: 034838.200
Applications:, Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product,...
| Keywords: | Anti-DTWD1, Anti-MDS009, Anti-DTW domain-containing protein 1 |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
Item number: 373105.1
Source:, Recombinant protein corresponding to aa1-109 from human DTWD1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.2kD, AA Sequence: MSLNPPIFLKRSEENSSKFVETKQSQTTSIASEDPLQNLCLASQEVLQKAQQSGRSKCLKCGGSRMFYCYTCYVPVENVPIEQIPLVKLPLKIDIIKHPNETDGKSTAI, Storage and Stability: May be stored...
| Keywords: | DTWD1, MDS009, DTW domain-containing protein 1 |
| MW: | 39,2 |
From 603.00€
*
Item number: ATA-APrEST82659.100
Protein function: Catalyzes the formation of 3-(3-amino-3-carboxypropyl)uridine (acp3U) at position 20 in the D-loop of several cytoplasmic tRNAs (acp3U(20)). [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | DTW domain-containing protein 1, tRNA-uridine aminocarboxypropyltransferase 1 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ELK-ES16884.100
Protein function: Catalyzes the formation of 3-(3-amino-3-carboxypropyl)uridine (acp3U) at position 20 in the D-loop of several cytoplasmic tRNAs (acp3U(20)). [The UniProt Consortium] Recommended dilutions: WB 1:500-2000. Cellular localization: Nucleus .
| Keywords: | Anti-DTW domain-containing protein 1, Anti-tRNA-uridine aminocarboxypropyltransferase 1, DTWD1 rabbit pAb |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 173.00€
*
Item number: CSB-CL839801HU1.10
Length: 915 Sequence: atgtctctca atccacctat atttctcaaa cgaagtgaag aaaatagttc aaaatttgtg gaaacaaaac agtcacaaac tacttccata gcttcagaag atccccttca aaacttatgt ttagcatctc aagaagttct tcaaaaagct cagcaaagtg ggagatcaaa atgtctcaaa tgtggtggtt ccagaatgtt ctactgctat acatgttatg ttccagttga aaatgtacct attgaacaga ttccacttgt...
| Keywords: | DTW domain-containing protein 1, tRNA-uridine aminocarboxypropyltransferase 1 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
Item number: CSB-CL839801HU2.10
Length: 330 Sequence: atgtctctca atccacctat atttctcaaa cgaagtgaag aaaatagttc aaaatttgtg gaaacaaaac agtcacaaac tacttccata gcttcagaag atccccttca aaacttatgt ttagcatctc aagaagttct tcaaaaagct cagcaaagtg ggagatcaaa atgtctcaaa tgtggtggtt ccagaatgtt ctactgctat acatgttatg ttccagttga aaatgtacct attgaacaga ttccacttgt...
| Keywords: | DTW domain-containing protein 1, tRNA-uridine aminocarboxypropyltransferase 1 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
Item number: CSB-PA007219EA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: DTWD1. Antigen Species: Human
| Keywords: | Anti-DTW domain-containing protein 1, Anti-tRNA-uridine aminocarboxypropyltransferase 1, DTW domain containing 1 antibody,... |
| Application: | ELISA, IHC, IF |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA007219EC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: DTWD1. Antigen Species: Human
| Keywords: | Anti-DTW domain-containing protein 1, Anti-tRNA-uridine aminocarboxypropyltransferase 1, DTW domain containing 1 antibody,... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*