- Search results for Q8N142
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
16 products were found matching "Q8N142"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA052621.100
Polyclonal Antibody against Human ADSS1, Gene description: adenylosuccinate synthase 1, Alternative Gene Names: ADSSL1, FLJ38602, Validated applications: IHC, Uniprot ID: Q8N142, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Component of the purine...
| Keywords: | Anti-AdSS 1, Anti-AdSSL1, Anti-AMPSase 1, Anti-IMP--aspartate ligase 1, Anti-M-type adenylosuccinate synthetase,... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ATA-HPA052621.25
Polyclonal Antibody against Human ADSS1, Gene description: adenylosuccinate synthase 1, Alternative Gene Names: ADSSL1, FLJ38602, Validated applications: IHC, Uniprot ID: Q8N142, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Component of the purine...
| Keywords: | Anti-AdSS 1, Anti-AdSSL1, Anti-AMPSase 1, Anti-IMP--aspartate ligase 1, Anti-M-type adenylosuccinate synthetase,... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Item number: 031666-FITC.200
Applications:, Suitable for use in Western Blot, Immunohistochemistry, FLISA, Recommended Dilution: FLISA: 1:1,000, Western Blot: 1:100-500, Immunohistochemistry: 1:50-100, Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated...
| Keywords: | Anti-ADSS1, Anti-AdSS 1, Anti-ADSSL1, Anti-AMPSase 1, EC=6.3.4.4, Anti-IMP--aspartate ligase 1, Anti-M-type... |
| Application: | FLISA, IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
1,104.00€
*
Item number: 031666.200
Applications:, Suitable for use in Western Blot, Immunohistochemistry, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Immunohistochemistry: 1:50-100, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are...
| Keywords: | Anti-ADSS1, Anti-AdSS 1, Anti-ADSSL1, Anti-AMPSase 1, EC=6.3.4.4, Anti-IMP--aspartate ligase 1, Anti-M-type... |
| Application: | ELISA, IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
865.00€
*
Item number: ELK-ES13857.100
This gene encodes a member of the adenylosuccinate synthase family of proteins. The encoded muscle-specific enzyme plays a role in the purine nucleotide cycle by catalyzing the first step in the conversion of inosine monophosphate (IMP) to adenosine monophosphate (AMP). Mutations in this gene may cause adolescent...
| Keywords: | Anti-AdSSL1, Anti-AdSS 1, Anti-AMPSase 1, Anti-IMP--aspartate ligase 1, Anti-Adenylosuccinate synthetase-like 1,... |
| Application: | WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 173.00€
*
Item number: CSB-CL836641HU.10
Length: 1374 Sequence: atgtcgggga cccgagcctc caacgaccgg ccccccggcg caggcggcgt caagcggggg cggctgcagc aggaggcggc ggcgaccggc tcccgcgtga cggtggtgct gggcgcgcag tggggggacg agggcaaagg caaggtggtg gacctgctgg ccacggacgc cgacatcatc agccgctgcc aggggggcaa caacgccggc cacacggtgg tggtggatgg gaaagagtac gacttccacc tgctgcccag...
| Keywords: | AdSS 1, AdSSL1, AMPSase 1, IMP--aspartate ligase 1, M-type adenylosuccinate synthetase, Adenylosuccinate synthetase-like... |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
508.00€
*
Item number: ABS-PP-4164.100
Protein function: Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP. [The UniProt Consortium]
| Keywords: | Adenylosuccinate synthetase isozyme 1, AMPSase 1, AdSS 1, Adenylosuccinate synthetase, basic isozyme, Adenylosuccinate... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 51.5 kD |
From 90.00€
*
Item number: ATA-APrEST95780.100
PrEST Antigen ADSS1, Gene description: adenylosuccinate synthase 1, Alternative Gene Names: ADSSL1, FLJ38602, Antigen sequence: DILDVLGEVKVGVSYKLNGKRIPYFPANQEMLQKVEVEYETLPGWKADTTGARRWEDLPPQAQNYIRFVENHVGVAVKWVGVG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Component of...
| Keywords: | AdSSL1, AdSS 1, AMPSase 1, IMP--aspartate ligase 1, Adenylosuccinate synthetase-like 1, M-type adenylosuccinate... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ABS-KC-33820.100
Protein function: Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP. [The UniProt Consortium]
| Keywords: | Anti-AdSS 1, Anti-AdSSL1, Anti-AMPSase 1, Anti-IMP--aspartate ligase 1, Anti-Adenylosuccinate synthetase-like 1,... |
| Application: | WB |
| Host: | Mouse |
| Species reactivity: | human |
From 206.00€
*
Item number: ABS-KC-34418.100
Protein function: Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP. [The UniProt Consortium]
| Keywords: | Anti-AdSS 1, Anti-AdSSL1, Anti-AMPSase 1, Anti-IMP--aspartate ligase 1, Anti-Adenylosuccinate synthetase-like 1,... |
| Application: | WB |
| Host: | Mouse |
| Species reactivity: | human |
From 206.00€
*
Item number: ABS-KC-35080.100
Protein function: Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP. [The UniProt Consortium]
| Keywords: | Anti-AdSS 1, Anti-AdSSL1, Anti-AMPSase 1, Anti-IMP--aspartate ligase 1, Anti-Adenylosuccinate synthetase-like 1,... |
| Application: | WB |
| Host: | Mouse |
| Species reactivity: | human |
From 206.00€
*
Item number: ABS-KC-34953.100
Protein function: Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP. [The UniProt Consortium]
| Keywords: | Anti-AdSS 1, Anti-AdSSL1, Anti-AMPSase 1, Anti-IMP--aspartate ligase 1, Anti-Adenylosuccinate synthetase-like 1,... |
| Application: | IHC |
| Host: | Mouse |
| Species reactivity: | human |
From 206.00€
*