- Search results for Q86YR7
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
12 products were found matching "Q86YR7"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA038946.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 30% and to rat: 29%
| Keywords: | Anti-DRG, Anti-MCF2L2, Anti-MCF2-transforming sequence-like protein 2, Anti-Probable guanine nucleotide exchange factor... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Item number: ATA-HPA038947.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 28% and to rat: 28%
| Keywords: | Anti-DRG, Anti-MCF2L2, Anti-MCF2-transforming sequence-like protein 2, Anti-Probable guanine nucleotide exchange factor... |
| Application: | ICC, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Item number: ABS-KC-2717.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium]
| Keywords: | Anti-Probable guanine nucleotide exchange factor MCF2L2, Anti-Dbs-related Rho family guanine nucleotide exchange factor,... |
| Application: | IHC |
| Host: | Mouse |
| Species reactivity: | human |
From 206.00€
*
Item number: ABS-KC-2724.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium]
| Keywords: | Anti-Probable guanine nucleotide exchange factor MCF2L2, Anti-Dbs-related Rho family guanine nucleotide exchange factor,... |
| Application: | IHC |
| Host: | Mouse |
| Species reactivity: | human |
From 206.00€
*
Item number: ATA-HPA061485.100
Polyclonal Antibody against Human MCF2L2, Gene description: MCF.2 cell line derived transforming sequence-like 2, Alternative Gene Names: ARHGEF22, KIAA0861, Validated applications: ICC, Uniprot ID: Q86YR7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Keywords: | Anti-DRG, Anti-MCF2L2, Anti-MCF2-transforming sequence-like protein 2, Anti-Probable guanine nucleotide exchange factor... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ABS-KC-17179.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium]
| Keywords: | Anti-DRG, Anti-MCF2L2, Anti-MCF2-transforming sequence-like protein 2, Anti-Probable guanine nucleotide exchange factor... |
| Application: | IHC |
| Host: | Mouse |
| Species reactivity: | human |
From 206.00€
*
Item number: ABS-PP-9046-L.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium]
| Keywords: | Probable guanine nucleotide exchange factor MCF2L2, Dbs-related Rho family guanine nucleotide exchange factor,... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 58.5 kD |
From 115.00€
*
Item number: ATA-APrEST79286.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | DRG, MCF2L2, MCF2-transforming sequence-like protein 2, Probable guanine nucleotide exchange factor MCF2L2, Dbs-related... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ATA-APrEST79287.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | DRG, MCF2L2, MCF2-transforming sequence-like protein 2, Probable guanine nucleotide exchange factor MCF2L2, Dbs-related... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ELK-ES19613.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium] Recommended dilutions: WB 1:1000-2000. Cellular localization:
| Keywords: | Anti-MCF2L2, Anti-ARHGEF22, Anti-MCF2-transforming sequence-like protein 2, Anti-Probable guanine nucleotide exchange... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, rat, mouse, |
From 173.00€
*
Item number: ABS-PP-9046.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium]
| Keywords: | Probable guanine nucleotide exchange factor MCF2L2, Dbs-related Rho family guanine nucleotide exchange factor,... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 58.5 kD |
From 90.00€
*
Item number: ATA-APrEST95865.100
PrEST Antigen MCF2L2, Gene description: MCF.2 cell line derived transforming sequence-like 2, Alternative Gene Names: ARHGEF22, KIAA0861, Antigen sequence: MLSTEDLLMSHTRQRDKLQDELKLLGKQGTTLLSCIQEPATKCPNSKLNLNQLENVTTMERLLVQLDETEKAFSHFWSEHHLKLNQCLQLQHFEHDF, Storage: Upon delivery store at -20°C. Avoid repeated...
| Keywords: | DRG, MCF2L2, MCF2-transforming sequence-like protein 2, Probable guanine nucleotide exchange factor MCF2L2, Dbs-related... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*