6 products were found matching "Q86W67"!
No results were found for the filter!
Anti-FAM228A
Item number: ABS-KC-3163.100
| Keywords: | Anti-Protein FAM228A, FAM228A Antibody |
| Application: | IHC |
| Host: | Mouse |
| Species reactivity: | human |
From 206.00€
*
Anti-FAM228A
Item number: ATA-HPA075817.100
Polyclonal Antibody against Human FAM228A, Gene description: family with sequence similarity 228 member A, Alternative Gene Names: C2orf84, FLJ30851, Validated applications: ICC, Uniprot ID: Q86W67, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 35% Rat...
| Keywords: | Anti-FAM228A, Anti-C2orf84, Anti-Protein FAM228A |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
FAM228A (human), recombinant protein
Item number: ABS-PP-9848-L.100
| Keywords: | Protein FAM228A, Recombinant Human FAM228A Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 10.5 kD |
From 115.00€
*
Anti-FAM228A
Item number: ABS-OC-447.100
| Keywords: | Anti-Protein FAM228A, FAM228A Antibody |
| Application: | WB |
| Host: | Mouse |
| Species reactivity: | human, rat |
From 206.00€
*
FAM228A (human), recombinant protein
Item number: ABS-PP-9848.100
| Keywords: | Protein FAM228A, Recombinant Human FAM228A Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 10.5 kD |
From 90.00€
*
FAM228A PrEST Antigen
Item number: ATA-APrEST96157.100
PrEST Antigen FAM228A, Gene description: family with sequence similarity 228 member A, Alternative Gene Names: C2orf84, FLJ30851, Antigen sequence: FTFTSHCVIPKEWHKASARARSKTYKYSPEKLIYADKKQKRKEKKTADLSQAAFERQFLSSKLSQKNKVGERKGLVSRGLGRGWHAGLCSTHE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles....
| Keywords: | FAM228A, C2orf84, Protein FAM228A |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*