16 products were found matching "Q86SG5"!
No results were found for the filter!
Human S100A15 (S100 Calcium Binding Protein A15) ELISA Kit
Item number: ELK-ELK7320.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human S100A15. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human S100A15....
| Keywords: | S100A7A, S100A15, Protein S100-A7A, S100 calcium-binding protein A15, S100 calcium-binding protein A7A, S100... |
| Application: | ELISA |
| Species reactivity: | human |
From 374.00€
*
Protein S100-A7A (S100A7A), partial, human, recombinant
Item number: CSB-YP771423HU.1
Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 2-101aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: SNTQAERSII GMIDMFHKYT GRDGKIEKPS LLTMMKENFP NFLSACDKKG IHYLATVFEK KDKNEDKKID FSEFLSLLGD IAADYHKQSH GAAPCSGGSQ. Purity: Greater than 90% as determined by...
| Keywords: | S100A15, S100A7A, Protein S100-A7A, S100 calcium-binding protein A7A, S100 calcium-binding protein A15, S100... |
| Application: | Activity not tested |
| Expressed in: | Yeast |
| Origin: | human |
| MW: | 13.2 kD |
From 265.00€
*
Protein S100-A7A (S100A7A), partial, human, recombinant
Item number: CSB-EP771423HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 2-101aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: SNTQAERSII GMIDMFHKYT GRDGKIEKPS LLTMMKENFP NFLSACDKKG IHYLATVFEK KDKNEDKKID FSEFLSLLGD IAADYHKQSH GAAPCSGGSQ. Purity: Greater than 90% as determined...
| Keywords: | S100A15, S100A7A, Protein S100-A7A, S100 calcium-binding protein A7A, S100 calcium-binding protein A15, S100... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 27.2 kD |
From 219.00€
*
S100A7A Protein, Human, Recombinant (His)
Item number: TGM-TMPH-01951-100ug
Description: May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases. S100A7A Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 13.2 kDa and the accession number is...
| Keywords: | S100 calcium-binding protein A7-like 1, S100 calcium-binding protein A15, S100 calcium-binding protein A7A, Protein... |
| MW: | 13.2 kD |
From 217.00€
*
NEW
Human S100A15 (S100 Calcium Binding Protein A15) ELISA...
Item number: G-AEKE10431.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human S100A15. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human S100A15....
| Keywords: | S100A7A, Protein S100-A7A, S100 calcium-binding protein A7A, S100 calcium-binding protein A15, S100 calcium-binding... |
| Application: | ELISA |
| Species reactivity: | human |
694.00€
*
NEW
S100A7A Protein, Human, Recombinant (His)
Item number: TGM-TMPH-01951-10ug
Description: May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases. S100A7A Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 13.2 kDa and the accession number is...
| Keywords: | S100 calcium-binding protein A7A , S100A7L1 , Protein S100-A7A , S100 calcium-binding protein A7-like 1 , S100A7A ,... |
| MW: | 13.2 kD |
From 81.00€
*
Anti-S100A7A
Item number: CSB-PA771423ZA01HU.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-S100A7A, Anti-S100A15, Anti-Protein S100-A7A, Anti-S100 calcium-binding protein A15, Anti-S100 calcium-binding... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Homo sapiens (Human) |
1,529.00€
*
Human Protein S100-A7A (S100A7A) ELISA kit
Item number: CSB-EL020636HU.48
Sample Types: serum, plasma, tissue homogenates, urine Detection Range: 0.312 ng/mL-20 ng/mL Sensitivity: 0.078 ng/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: May be involved in epidermal differentiation and inflammation...
| Keywords: | S100A15, S100A7A, Protein S100-A7A, S100 calcium-binding protein A15, S100 calcium-binding protein A7A, S100... |
| Application: | ELISA, Sandwich ELISA |
| Species reactivity: | human |
From 581.00€
*
S100A7A (human), recombinant protein
Item number: ABS-PP-5182-L.100
Protein function: May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases. [The UniProt Consortium]
| Keywords: | Protein S100-A7A, S100 calcium-binding protein A15, S100 calcium-binding protein A7-like 1, S100 calcium-binding protein... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 12.5 kD |
From 115.00€
*
Anti-S100A7A
Item number: CSB-PA771423ZA01HU.2
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-S100A7A, Anti-S100A15, Anti-Protein S100-A7A, Anti-S100 calcium-binding protein A15, Anti-S100 calcium-binding... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Homo sapiens (Human) |
From 1,529.00€
*
Anti-S100A15 (S100 Calcium Binding Protein A15, S100A7A,...
Item number: 364956.200
The human calcium-binding protein (hS100A15) was first identified in inflamed hyperplastic psoriatic skin, where the S100A15 gene is transcribed into two mRNA splice variants, hS100A15-S and hS100A15-L. In cultured keratinocytes, IL-1beta and Th1 cytokines significantly induced hS100A15-L compared with hS100A15-S....
| Keywords: | Anti-S100A15, Anti-S100A7A, Anti-Protein S100-A7A, Anti-S100 calcium-binding protein A7A, Anti-S100 calcium-binding... |
| Application: | ELISA, ICC, IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
675.00€
*
S100A7A, Recombinant, Human, aa2-101, His-SUMO-Tag...
Item number: 375182.100
Source:, Recombinant protein corresponding to aa2-101 from human S100A7A, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.2kD, AA Sequence: SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ, Storage and Stability: May be stored at...
| Keywords: | S100A15, S100A7A, Protein S100-A7A, S100 calcium-binding protein A7A, S100 calcium-binding protein A15, S100... |
| MW: | 27,2 |
From 603.00€
*