11 products were found matching "Q7Z7F7"!

No results were found for the filter!
Anti-MRPL55
Anti-MRPL55

Item number: ATA-HPA027641.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 79% and to rat: 78%
Keywords: Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal...
Application: ICC, IHC
Host: Rabbit
Species reactivity: human
From 246.00€ *
Review
39S ribosomal protein L55, mitochondrial (MRPL55), human, recombinant
39S ribosomal protein L55, mitochondrial (MRPL55), human,...

Item number: CSB-EP014872HU.1

Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 34-128aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal GST-tagged. Target Protein Sequence: DSSRASLTRV HRQAYARLYP VLLVKQDGST IHIRYREPRR MLAMPIDLDT LSPEERRARL RKREAQLQSR KEYEQELSDD LHVERYRQFW TRTKK. Purity: Greater than 90% as...
Keywords: L55mt, MRPL55, MRP-L55, 39S ribosomal protein L55, mitochondrial, Mitochondrial large ribosomal subunit protein mL55,...
Application: Activity not tested
Expressed in: E.coli
Origin: human
MW: 38.6 kD
From 219.00€ *
Review
MRPL55, Recombinant, Human, aa34-128, GST-Tag (39S Ribosomal Protein L55, Mitochondrial)
MRPL55, Recombinant, Human, aa34-128, GST-Tag (39S...

Item number: 374273.1

Source:, Recombinant protein corresponding to aa34-128 from human MRPL55, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.6kD, AA Sequence: DSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK, Storage and Stability: May be stored at 4°C for...
Keywords: L55mt, MRPL55, MRP-L55, 39S ribosomal protein L55, mitochondrial, Mitochondrial large ribosomal subunit protein mL55,...
MW: 38,6
From 603.00€ *
Review
MRPL55 PrEST Antigen
MRPL55 PrEST Antigen

Item number: ATA-APrEST77022.100

Buffer: PBS and 1M Urea, pH 7.4.
Keywords: L55mt, MRPL55, MRP-L55, 39S ribosomal protein L55, mitochondrial, Mitochondrial large ribosomal subunit protein mL55,...
Application: Control antigen
Expressed in: E.coli
Origin: human
264.00€ *
Review
Anti-MRPL55
Anti-MRPL55

Item number: G-CAB18242.20

MRPL55 Rabbit Polyclonal Antibody from Assay Genie with reactivity against Human and for use in WB applications.MRPL55 Rabbit Polyclonal Antibody is an IgG isotype antibody and produced in Rabbit and purified by Affinity purification from Assay Genie.
Keywords: Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal...
Application: WB
Host: Rabbit
Species reactivity: human
103.00€ *
Review
Anti-RM55
Anti-RM55

Item number: ELK-ES9307.100

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
Keywords: Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-Large ribosomal subunit protein mL55, Anti-39S ribosomal protein L55,...
Application: WB, ELISA
Host: Rabbit
Species reactivity: human, mouse
From 173.00€ *
Review
MRPL55 (Vector Vector will be determined during the manufacturing process, either pENTR223.1 or pUC,
MRPL55 (Vector Vector will be determined during the...

Item number: CSB-CL768781HU.10

Length: 387 Sequence: atggcggccg tgggcagcct gcttggccgg ctgaggcaga gcaccgtgaa ggccaccgga cctgcactcc gccgcctgca cacatcctcc tggcgagctg acagcagcag ggcctcactc actcgtgtgc accgccaggc ttatgcacga ctctaccccg tgctgctggt gaagcaggat ggctccacca tccacatccg ctacagggag ccacggcgca tgctggcgat gcccatagat ctggacaccc tgtctcctga...
Keywords: L55mt, MRPL55, MRP-L55, 39S ribosomal protein L55, mitochondrial, Mitochondrial large ribosomal subunit protein mL55,...
Application: Molecular biology, clone
Species reactivity: human
176.00€ *
Review
Anti-MRPL55
Anti-MRPL55

Item number: CSB-PA014872EA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MRPL55. Antigen Species: Human
Keywords: Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal...
Application: ELISA, WB, IHC
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Anti-MRPL55, FITC conjugated
Anti-MRPL55, FITC conjugated

Item number: CSB-PA014872EC01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MRPL55. Antigen Species: Human
Keywords: Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal...
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Anti-MRPL55, HRP conjugated
Anti-MRPL55, HRP conjugated

Item number: CSB-PA014872EB01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MRPL55. Antigen Species: Human
Keywords: Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal...
Application: ELISA
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Anti-MRPL55, Biotin conjugated
Anti-MRPL55, Biotin conjugated

Item number: CSB-PA014872ED01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MRPL55. Antigen Species: Human
Keywords: Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal...
Application: ELISA
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review