8 products were found matching "Q7TNV9"!
No results were found for the filter!
Mouse Beta-defensin 14 / Defb14 ELISA Kit
Item number: G-MOFI00252.96
| Application: | ELISA |
| Species reactivity: | mouse |
698.00€
*
Anti-Defb14
Item number: G-PACO36866.50
Defb14 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Mouse, Rat and for use in ELISA, WB applications. Defb14 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Has antibacterial activity. [The UniProt Consortium]
| Keywords: | Anti-BD-14, Anti-Defb14, Anti-mBD-14, Anti-Beta-defensin 14, Anti-Defensin, beta 14 |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | mouse, rat |
313.00€
*
Beta-defensin 14 (Defb14), mouse, recombinant
Item number: CSB-EP749254MO.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 23-67aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: FLPKTLRKFF CRIRGGRCAV LNCLGKEEQI GRCSNSGRKC CRKKK. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin: Not test....
| Keywords: | BD-14, Defb14, mBD-14, Beta-defensin 14, Defensin, beta 14, Recombinant Mouse Beta-defensin 14 (Defb14) |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | mouse |
| MW: | 21.2 kD |
From 292.00€
*
Defb14, Recombinant, Mouse, aa23-67, His-SUMO-Tag...
Item number: 373030.100
Has antibacterial activity. Source: Recombinant protein corresponding to aa23-67 from mouse Defb14, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~21.2kD, AA Sequence: FLPKTLRKFFCRIRGGRCAVLNCLGKEEQIGRCSNSGRKCCRKKK, Storage and Stability: May be stored at 4°C for short-term only....
| Keywords: | BD-14, mBD-14, Defb14, Beta-defensin 14, Defensin, beta 14 |
| MW: | 21,2 |
From 690.00€
*
Anti-Defb14
Item number: CSB-PA749254HA01MO.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Defb14. Antigen Species: Mouse
| Keywords: | Anti-BD-14, Anti-mBD-14, Anti-Defb14, Anti-Beta-defensin 14, Anti-Defensin, beta 14, Defb14 antibody, Beta-defensin 14... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | mouse, rat |
From 167.00€
*
Anti-Defb14, HRP conjugated
Item number: CSB-PA749254HB01MO.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Defb14. Antigen Species: Mouse
| Keywords: | Anti-BD-14, Anti-mBD-14, Anti-Defb14, Anti-Beta-defensin 14, Anti-Defensin, beta 14, Defb14 antibody, Beta-defensin 14... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | mouse |
From 167.00€
*
Anti-Defb14, FITC conjugated
Item number: CSB-PA749254HC01MO.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Defb14. Antigen Species: Mouse
| Keywords: | Anti-BD-14, Anti-mBD-14, Anti-Defb14, Anti-Beta-defensin 14, Anti-Defensin, beta 14, Defb14 antibody, Beta-defensin 14... |
| Host: | Rabbit |
| Species reactivity: | mouse |
From 167.00€
*
Anti-Defb14, Biotin conjugated
Item number: CSB-PA749254HD01MO.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Defb14. Antigen Species: Mouse
| Keywords: | Anti-BD-14, Anti-mBD-14, Anti-Defb14, Anti-Beta-defensin 14, Anti-Defensin, beta 14, Defb14 antibody, Beta-defensin 14... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | mouse |
From 167.00€
*