- Search results for Q6UXT8
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
13 products were found matching "Q6UXT8"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA027368.100
Protein function: Ligand for receptor tyrosine kinase LTK and perhaps receptor tyrosine kinase ALK, activation of ALK is reported conflictingly. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 65% and to rat: 70%
| Keywords: | Anti-FAM150A, Anti-AUG-beta, Anti-Augmentor beta, Anti-Protein FAM150A, Anti-ALK and LTK ligand 1 |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Item number: CSB-BP757795HU.1
Organism: Homo sapiens (Human). Source: Baculovirus. Expression Region: 28-129aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Target Protein Sequence: RPRGRRGARV TDKEPKPLLF LPAAGAGRTP SGSRSAEIFP RDSNLKDKFI KHFTGPVTFS PECSKHFHRL YYNTRECSTP AYYKRCARLL...
| Keywords: | FAM150A, AUG-beta, Augmentor beta, Protein FAM150A, ALK and LTK ligand 1, Recombinant Human ALK and LTK ligand 1 (ALKAL1) |
| Application: | Activity not tested |
| Expressed in: | Insect cells |
| Origin: | human |
| MW: | 15.4 kD |
From 489.00€
*
Item number: CSB-EP757795HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 28-129aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-B2M-tagged. Target Protein Sequence: RPRGRRGARV TDKEPKPLLF LPAAGAGRTP SGSRSAEIFP RDSNLKDKFI KHFTGPVTFS PECSKHFHRL YYNTRECSTP AYYKRCARLL TRLAVSPLCS QT. Purity: Greater...
| Keywords: | FAM150A, AUG-beta, Augmentor beta, Protein FAM150A, ALK and LTK ligand 1, Recombinant Human ALK and LTK ligand 1 (ALKAL1) |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 25.5 kD |
From 292.00€
*
Item number: TGM-TMPY-04317-100ug
Description: FAM150A Protein, Human, Recombinant (mFc) is expressed in HEK293 mammalian cells with mFc tag. The predicted molecular weight is 37.93 kDa and the accession number is Q6UXT8.
| Keywords: | FAM150A, UNQ9433, family with sequence similarity 150 member A |
| MW: | 37.93 kD |
768.00€
*
Item number: TGM-TMPY-04317-10ug
Description: FAM150A Protein, Human, Recombinant (mFc) is expressed in HEK293 mammalian cells with mFc tag. The predicted molecular weight is 37.93 kDa and the accession number is Q6UXT8.
| Keywords: | FAM150A , UNQ9433 , family with sequence similarity 150 member A |
| MW: | 37.93 kD |
From 75.00€
*
Item number: 374877.100
Source:, Recombinant protein corresponding to aa28-129 from human FAM150A, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.5kD, AA Sequence: RPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDSNLKDKFIKHFTGPVTFSPECSKHFHRLYYNTRECSTPAYYKRCARLLTRLAVSPLCSQT, Storage and Stability: May be stored...
| Keywords: | FAM150A, AUG-beta, Augmentor beta, Protein FAM150A, ALK and LTK ligand 1 |
| MW: | 27,5 |
From 690.00€
*
Item number: ATA-APrEST76439.100
Protein function: Ligand for receptor tyrosine kinase LTK and perhaps receptor tyrosine kinase ALK, activation of ALK is reported conflictingly. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | FAM150A, AUG-beta, Augmentor beta, Protein FAM150A, ALK and LTK ligand 1 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: E-PKSH030534.100
Protein function: Ligand for receptor tyrosine kinase LTK and perhaps receptor tyrosine kinase ALK, activation of ALK is reported conflictingly. [The UniProt Consortium]
| Origin: | human |
924.00€
*
Item number: G-RPES3663.100
Human FAM150A Recombinant Protein (RPES3663) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Ligand for receptor tyrosine kinase LTK and perhaps receptor tyrosine kinase ALK, activation of ALK is reported conflictingly. [The UniProt Consortium]
| Keywords: | FAM150A, AUG-beta, Augmentor beta, Protein FAM150A, ALK and LTK ligand 1 |
| Expressed in: | Human cells |
| Origin: | human |
1,471.00€
*
Item number: CSB-CL757795HU.10
Length: 390 Sequence: atgcggcccc ttaagcccgg cgcccctttg cccgcactct tcctgctggc gctggctttg tccccgcacg gagcccacgg gaggccccgg gggcgcaggg gagcgcgcgt cacggataag gagcccaagc cgttgctttt cctccccgcg gccggggccg gccggactcc cagcggctcc cggagcgcag aaatattccc aagagactct aacttaaaag acaaattcat aaagcatttc acagggccgg tcacattttc...
| Keywords: | FAM150A, AUG-beta, Augmentor beta, Protein FAM150A, ALK and LTK ligand 1 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
Item number: ABS-PQ-869.100
Protein function: Ligand for receptor tyrosine kinase LTK and perhaps receptor tyrosine kinase ALK, activation of ALK is reported conflictingly. [The UniProt Consortium]
| Keywords: | ALK and LTK ligand 1, Augmentor beta, AUG-beta, Recombinant Human ALKAL1 Protein |
| Expressed in: | human cells |
| Origin: | human |
| MW: | 12.5 kD |
From 270.00€
*
Item number: CSB-PA757795ZA01HU.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-FAM150A, Anti-AUG-beta, Anti-Augmentor beta, Anti-Protein FAM150A, Anti-ALK and LTK ligand 1, ALKAL1 Antibody |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Homo sapiens (Human) |
From 1,529.00€
*