- Search results for Q6P161
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
19 products were found matching "Q6P161"!
Close filters
Filter by:
No results were found for the filter!
Item number: CSB-PA003303.50
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Keywords: | Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | ELISA, WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
126.00€
*
Item number: ATA-HPA042117.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 49% and to rat: 54%
| Keywords: | Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Item number: ATA-HPA046767.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 84% and to rat: 82%
| Keywords: | Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | ICC, IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Item number: CSB-EP014871HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 15-138aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: GWGAWELLNP ATSGRLLARD YAKKPVMKGA KSGKGAVTSE ALKDPDVCTD PVQLTTYAMG VNIYKEGQDV PLKPDAEYPE WLFEMNLGPP KTLEELDPES REYWRRLRKQ NIWRHNRLSK...
| Keywords: | L54mt, MRPL54, MRP-L54, 39S ribosomal protein L54, mitochondrial, Mitochondrial large ribosomal subunit protein mL54,... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 18.2 kD |
From 219.00€
*
Item number: CSB-PA110296.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Keywords: | Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | ELISA, WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
284.00€
*
Item number: ABS-PP-10982-L.100
| Keywords: | Large ribosomal subunit protein mL54, 39S ribosomal protein L54, mitochondrial, L54mt, MRP-L54, Recombinant Human MRPL54... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 11 kD |
From 115.00€
*
Item number: 038601.200
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
| Keywords: | Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
Item number: 374272.100
Source:, Recombinant protein corresponding to aa15-138 from human MRPL54, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~18.2kD, AA Sequence: GWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVCTDPVQLTTYAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKRL, Storage and Stability:...
| Keywords: | L54mt, MRPL54, MRP-L54, 39S ribosomal protein L54, mitochondrial, Mitochondrial large ribosomal subunit protein mL54 |
| MW: | 18,2 |
From 603.00€
*
Item number: ATA-APrEST82828.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | L54mt, MRPL54, MRP-L54, 39S ribosomal protein L54, mitochondrial, Mitochondrial large ribosomal subunit protein mL54 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ATA-APrEST82829.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | L54mt, MRPL54, MRP-L54, 39S ribosomal protein L54, mitochondrial, Mitochondrial large ribosomal subunit protein mL54 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: G-CAB14957.20
MRPL54 Rabbit Polyclonal Antibody from Assay Genie with reactivity against Human and for use in WB IHC applications.MRPL54 Rabbit Polyclonal Antibody is an IgG isotype antibody and produced in Rabbit and purified by Affinity purification from Assay Genie.
| Keywords: | Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
103.00€
*
Item number: ABD-8C14052.50
Custom conjugation services for this antibody as available (eg. labeling of Anti-MRPL54 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
| Keywords: | Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | WB, IHC, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
628.00€
*