20 products were found matching "Q6P161"!
No results were found for the filter!
Anti-MRPL54
Item number: CSB-PA003303.50
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Keywords: | Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | ELISA, WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
126.00€
*
Anti-MRPL54
Item number: ATA-HPA042117.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 49% and to rat: 54%
| Keywords: | Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Anti-MRPL54
Item number: ATA-HPA046767.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 84% and to rat: 82%
| Keywords: | Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | ICC, IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
39S ribosomal protein L54, mitochondrial (MRPL54), human,...
Item number: CSB-EP014871HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 15-138aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: GWGAWELLNP ATSGRLLARD YAKKPVMKGA KSGKGAVTSE ALKDPDVCTD PVQLTTYAMG VNIYKEGQDV PLKPDAEYPE WLFEMNLGPP KTLEELDPES REYWRRLRKQ NIWRHNRLSK...
| Keywords: | L54mt, MRPL54, MRP-L54, 39S ribosomal protein L54, mitochondrial, Mitochondrial large ribosomal subunit protein mL54,... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 18.2 kD |
From 219.00€
*
Anti-MRPL54
Item number: CSB-PA110296.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Keywords: | Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | ELISA, WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
284.00€
*
Anti-MRPL54
Item number: E-AB-65164.120
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
| Keywords: | Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 243.00€
*
Anti-MRPL54, ID (MRPL54, 39S ribosomal protein L54,...
Item number: 038601.200
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
| Keywords: | Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
MRPL54, Recombinant, Human, aa15-138, His-Tag (39S...
Item number: 374272.1
Source:, Recombinant protein corresponding to aa15-138 from human MRPL54, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~18.2kD, AA Sequence: GWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVCTDPVQLTTYAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKRL, Storage and Stability:...
| Keywords: | L54mt, MRPL54, MRP-L54, 39S ribosomal protein L54, mitochondrial, Mitochondrial large ribosomal subunit protein mL54 |
| MW: | 18,2 |
From 603.00€
*
MRPL54 PrEST Antigen
Item number: ATA-APrEST82828.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | L54mt, MRPL54, MRP-L54, 39S ribosomal protein L54, mitochondrial, Mitochondrial large ribosomal subunit protein mL54 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
MRPL54 PrEST Antigen
Item number: ATA-APrEST82829.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | L54mt, MRPL54, MRP-L54, 39S ribosomal protein L54, mitochondrial, Mitochondrial large ribosomal subunit protein mL54 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Anti-MRPL54
Item number: G-CAB14957.100
WB 1:500 - 1:2000.
| Keywords: | Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 103.00€
*
Anti-MRPL54
Item number: ABD-8C14052.50
Custom conjugation services for this antibody as available (eg. labeling of Anti-MRPL54 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
| Keywords: | Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | WB, IHC, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
628.00€
*