- Search results for Q6NXP6
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
7 products were found matching "Q6NXP6"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA055658.100
Protein function: Probable oxidoreductase. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 64% and to rat: 66%
| Keywords: | Anti-NOXRED1, Anti-C14orf148, EC=1.-.-.-, Anti-Pyrroline-5-carboxylate reductase-like protein C14orf148,... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Item number: ATA-HPA060408.100
Polyclonal Antibody against Human NOXRED1, Gene description: NADP dependent oxidoreductase domain containing 1, Alternative Gene Names: C14orf148, FLJ32809, Validated applications: ICC, Uniprot ID: Q6NXP6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Keywords: | Anti-NOXRED1, Anti-C14orf148, EC=1.-.-.-, Anti-Pyrroline-5-carboxylate reductase-like protein C14orf148,... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ATA-HPA060408.25
Polyclonal Antibody against Human NOXRED1, Gene description: NADP dependent oxidoreductase domain containing 1, Alternative Gene Names: C14orf148, FLJ32809, Validated applications: ICC, Uniprot ID: Q6NXP6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Keywords: | Anti-NOXRED1, Anti-C14orf148, EC=1.-.-.-, Anti-Pyrroline-5-carboxylate reductase-like protein C14orf148,... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Item number: ATA-APrEST83676.100
Protein function: Probable oxidoreductase. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | NOXRED1, C14orf148, EC=1.-.-.-, Pyrroline-5-carboxylate reductase-like protein C14orf148, NADP-dependent oxidoreductase... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ABS-PP-6992.100
Protein function: Probable oxidoreductase. [The UniProt Consortium]
| Keywords: | NADP-dependent oxidoreductase domain-containing protein 1, Pyrroline-5-carboxylate reductase-like protein C14orf148,... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 27 kD |
From 90.00€
*
Item number: ATA-APrEST96008.100
PrEST Antigen NOXRED1, Gene description: NADP dependent oxidoreductase domain containing 1, Alternative Gene Names: C14orf148, FLJ32809, Antigen sequence: LGIKCFYHNADLVSWADVIFLCCLPSQLPNICVEIYTSLEKASIVYSFVAAIPLPRLKLLLNHTNILRPQYQYDEDSVSVWGANKGVIAALQDPTILQATC, Storage: Upon delivery store at -20°C. Avoid repeated...
| Keywords: | NOXRED1, C14orf148, EC=1.-.-.-, Pyrroline-5-carboxylate reductase-like protein C14orf148, NADP-dependent oxidoreductase... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ABS-PP-6992-L.100
Protein function: Probable oxidoreductase. [The UniProt Consortium]
| Keywords: | NADP-dependent oxidoreductase domain-containing protein 1, Pyrroline-5-carboxylate reductase-like protein C14orf148,... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 27 kD |
From 115.00€
*