7 products were found matching "Q6AYE8"!
No results were found for the filter!
Artemin (Artn), rat, recombinant
Item number: CSB-EP002160RA.1
Organism: Rattus norvegicus (Rat). Source: E.coli. Expression Region: 112-224aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Target Protein Sequence: AGTRSSRARA TDARGCRLRS QLVPVSALGL GHSSDELIRF RFCSGSCRRA RSPHDLSLAS LLDAGALRSP PGSRPISQPC CRPTRYEAVS...
| Keywords: | Artn, Artemin, Recombinant Rat Artemin (Artn) |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | rat |
| MW: | 17.1kDa kD |
From 364.00€
*
Artemin Protein, Rat, Recombinant (His & Myc)
Item number: TGM-TMPH-03247-100ug
Description: Ligand for the GFR-alpha-3-RET receptor complex but can also activate the GFR-alpha-1-RET receptor complex. Supports the survival of sensory and sympathetic peripheral neurons in culture and also supports the survival of dopaminergic neurons of the ventral mid-brain. Strong attractant of gut...
| Keywords: | Artemin, Artn |
| MW: | 17.1 kD |
From 340.00€
*
NEW
Artemin Protein, Rat, Recombinant (His & Myc)
Item number: TGM-TMPH-03247-10ug
Description: Ligand for the GFR-alpha-3-RET receptor complex but can also activate the GFR-alpha-1-RET receptor complex. Supports the survival of sensory and sympathetic peripheral neurons in culture and also supports the survival of dopaminergic neurons of the ventral mid-brain. Strong attractant of gut...
| Keywords: | Artn , Artemin |
| MW: | 17.1 kD |
From 122.00€
*
Artn, Rat artemin, Real Time PCR Primer Set
Item number: VRPS-455
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | Artn, Artemin |
| Application: | RNA quantification |
54.00€
*
Artemin (ARTN) Recombinant, Rat
Item number: 153610.10
Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q6AYE8, Fragment: Ala112~Gly224 (Accession No: Q6AYE8), Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-AGTRSSRAR ATDARGCRLR SQLVPVSALG LGHSSDELIR FRFCSGSCRR ARSPHDLSLA SLLDAGALRS PPGSRPISQP...
From 454.00€
*
Artemin, Recombinant, Rat, aa112-224, His-Tag, Myc-Tag...
Item number: 517806.20
Ligand for the GFR-alpha-3-RET receptor complex but can also activate the GFR-alpha-1-RET receptor complex. Supports the survival of sensory and sympathetic peripheral neurons in culture and also supports the survival of dopaminergic neurons of the ventral mid-brain. Strong attractant of gut hematopoietic cells thus...
| Keywords: | Artn, Artemin |
| Expressed in: | E.coli |
| Origin: | rat |
| MW: | 17.1 kD |
From 786.00€
*
Anti-Artn
Item number: CSB-PA002160ZA01RA.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-Artn, Anti-Artemin, Artn Antibody |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Rattus norvegicus (Rat) |
From 1,529.00€
*