- Search results for Q64373
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
8 products were found matching "Q64373"!
Close filters
Filter by:
No results were found for the filter!
Item number: TGM-TMPY-02564-100ug
Description: BCL-XL Protein, Mouse, Recombinant (aa 1-212, His) is expressed in E. coli expression system with His tag. The predicted molecular weight is 25.2 kDa and the accession number is Q64373-1.
Keywords: | BclX, Bcl2l, bcl-x, Bcl-XL, Bcl(X)L, BCL2-like 1, bcl2-L-1 |
MW: | 25.2 kD |
699.00€
*
Item number: ELK-ELK7209.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse Bcl2L. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse Bcl2L. Next,...
Keywords: | Bcl2l, Bcl2l1, Bcl2-L-1, Bcl-2-like protein 1, Apoptosis regulator Bcl-X |
Application: | ELISA |
Species reactivity: | mouse |
From 374.00€
*

Item number: G-RPES4233.100
Mouse BCL2L1/Bcl-XL Recombinant Protein (RPES4233) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Potent inhibitor of cell death. Inhibits activation of caspases. Appears to regulate cell death by blocking the voltage- dependent anion channel (VDAC)...
Keywords: | Bcl2l, Bcl2l1, Bcl2-L-1, Bcl-2-like protein 1, Apoptosis regulator Bcl-X |
Expressed in: | E.coli |
Origin: | mouse |
1,465.00€
*

Item number: VMPS-628
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: | Bcl2l, Bcl2l1, Bcl2-L-1, Bcl-2-like protein 1, Apoptosis regulator Bcl-X |
Application: | RNA quantification |
44.00€
*

Item number: 152329.96
B-Cell CLL/Lymphoma 2 Like Protein (Bcl2L) BioAssay(TM) ELISA Kit (Mouse) is a Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to B-Cell CLL/Lymphoma 2 Like Protein (Bcl2L). Standards or samples are then added to the appropriate microtiter plate...
Keywords: | Bcl2l, Bcl2l1, Bcl2-L-1, Bcl-2-like protein 1, Apoptosis regulator Bcl-X |
Application: | ELISA |
Species reactivity: | mouse |
1,039.00€
*

Item number: 153643.10
Source:, Recombinant Mouse from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q64373, Fragment: Ser2~Arg212 (Accession No: Q64373), Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-SQSNRELVV DFLSYKLSQK GYSWSQFSDV EENRTEAPEE TEAERETPSA INGNPSWHLA DSPAVNGATG HSSSLDAREV...
From 379.00€
*

Item number: 351102.100
BCL2L1 also known as Bcl-2-like protein 1 isoform a. This protein is a member of BCL-2 protein family. BCL2L1 is located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. Also, BCL2L1 controls a switch between cell death modes during mitotic...
Keywords: | Bcl2l, Bcl2l1, Bcl2-L-1, Bcl-2-like protein 1, Apoptosis regulator Bcl-X |
Origin: | mouse |
MW: | 25.8 kD |
From 581.00€
*

Item number: E-PKSM040918.100
Activity: 1. Measured by its binding ability in a functional ELISA.2. Immobilized human BID at 10 µg/mL (100 µl/well) can bind biotinylated mouse BCL2L1, The EC50 of biotinylated mouse BCL2L1 is 5.6 ng/mL.3. Immobilized mouse BID at 10 µg/mL (100 µl/well) can bind biotinylated mouse BCL2L1, The EC50 of...
Keywords: | Bcl2l, Bcl2l1, Bcl2-L-1, Bcl-2-like protein 1, Apoptosis regulator Bcl-X, Recombinant Mouse BCL2L1 / Bcl-XL Protein (aa... |
Expressed in: | E.coli |
Origin: | mouse |
MW: | 25.2 kD |
1,435.00€
*