4 products were found matching "Q5VVC0"!

No results were found for the filter!

Item number: ATA-HPA074051.100

Polyclonal Antibody against Human C1orf146, Gene description: chromosome 1 open reading frame 146, Alternative Gene Names: SPO16, Validated applications: ICC, Uniprot ID: Q5VVC0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Plays a key role in...

Keywords:	Anti-C1orf146, Anti-Protein SPO16 homolog, Anti-Synaptonemal complex reinforcing element
Application:	ICC
Host:	Rabbit
Species reactivity:	human

491.00€ *

Show details

Review

Anti-CA146

Item number: ELK-ES17911.100

Protein function: Plays a key role in reinforcing the integrity of the central element of the synaptonemal complex (SC) thereby stabilizing SC, ensuring progression of meiotic prophase I in male and female germ cells. Promotes homologous recombination and crossing- over in meiotic prophase I via its association with...

Keywords:	Anti-C1orf146, Anti-Protein SPO16 homolog, Anti-Synaptonemal complex reinforcing element, CA146 rabbit pAb
Application:	WB
Host:	Rabbit
Species reactivity:	human, mouse

From 173.00€ *

Show details

Review

C1orf146 (Vector Vector will be determined during the...

Item number: CSB-CL716575HU.10

Length: 543 Sequence: atggctgaaa gtggaaaaga aaaaataaaa tggacaacca ccattattat tagctcatct cttaagagtt atgaagttgc aactgcccta gaaaatcgaa gccacaaagt tcgatattca gattcagtgg aaaatggatc aattatattt tctctttctg gagttgcatt tttattaatg gatactaagg aatgtcttct gtcaactgaa gaaatatttc tagccaaaat tgagaaattt attaacattc accaaaatag...

Keywords:	C1orf146, Protein SPO16 homolog, Synaptonemal complex reinforcing element
Application:	Molecular biology, clone
Species reactivity:	human

176.00€ *

Show details

Review

C1orf146 PrEST Antigen

Item number: ATA-APrEST96068.100

PrEST Antigen C1orf146, Gene description: chromosome 1 open reading frame 146, Alternative Gene Names: SPO16, Antigen sequence: VNAINLMCTIAKTTSKPYIDSICYRMITAKAYIIEQSPVWKTLQKIKLNSDSVNP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Plays a key role in reinforcing the...

Keywords:	C1orf146, Protein SPO16 homolog, Synaptonemal complex reinforcing element
Expressed in:	E.coli
Origin:	human

264.00€ *

Show details

Review

Didn't find the right Product? Here are some useful Search Tips!

Checklist-Thumbnail

All our products have English titles and descriptions. Therefore, use English search terms.
Write out Greek letters - i.e. "alpha" instead of α or "beta" instead of β.
Do not add "and" when entering multiple search terms.
Use the singular (e.g. "antibody" instead of "antibodies").
If available, try synonyms (e.g. for a specific protein).
You can search for chemical substances using the unique CAS number (Chemical Abstracts Service).
In addition, you can also use the UniProt or KEGG accession number for the product search.
Use our filter function to narrow down your search results. If you want to remove a selected filter again, click on the small "x" next to the filter.
Are you looking for products from a specific supplier? Then enter the corresponding supplier name and select it in the appearing suggestion field. Alternatively, you can also use our supplier overview.
Use - if known - the specific product number. Especially for short numbers, note the supplier code in front of each number for most of our partners (e.g. for AAT Bioquest "ABD-121" instead of just "121"). Click on the button below to find all supplier codes and additional information.

All Supplier Codes

We would be very happy to support you in your product search! Contact us at info@biomol.com.