- Search results for Q5T5X7
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
11 products were found matching "Q5T5X7"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA017891.100
Protein function: Transcriptional repressor which associates with the NoRC (nucleolar remodeling complex) complex and plays a key role in repressing rDNA transcription. The sumoylated form modulates the stability of the NoRC complex component BAZ2A/TIP5 by controlling its USP21-mediated deubiquitination...
| Keywords: | Anti-BEND3, Anti-KIAA1553, Anti-BEN domain-containing protein 3 |
| Application: | IHC, ChIP |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Item number: CSB-YP729205HU.1
Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 328-461aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: CLPQLNDFFS RFWAQREMED SQPSGQVASF FEAEQVDPGH FLDNKDQEEA LSLDRSSTIA SDHVVDTQDL TEFLDEASSP GEFAVFLLHR LFPELFDHRK LGEQYSCYGD GGKQELDPQR LQIIRNYTEI YFPD....
| Keywords: | BEND3, KIAA1553, BEN domain-containing protein 3, Recombinant Human BEN domain-containing protein 3 (BEND3), partial |
| Application: | Activity not tested |
| Expressed in: | Yeast |
| Origin: | human |
| MW: | 17.5 kD |
From 242.00€
*
Item number: CSB-EP729205HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 328-461aa. Protein Length: Partial. Tag Info: N-terminal GST-tagged. Target Protein Sequence: CLPQLNDFFS RFWAQREMED SQPSGQVASF FEAEQVDPGH FLDNKDQEEA LSLDRSSTIA SDHVVDTQDL TEFLDEASSP GEFAVFLLHR LFPELFDHRK LGEQYSCYGD GGKQELDPQR LQIIRNYTEI YFPD. Purity:...
| Keywords: | BEND3, KIAA1553, BEN domain-containing protein 3, Recombinant Human BEN domain-containing protein 3 (BEND3), partial |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 42.5 kD |
From 219.00€
*
Item number: 032493.200
Applications:, Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product,...
| Keywords: | Anti-BEND3, Anti-KIAA1553, Anti-BEN domain-containing protein 3 |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
Item number: 372435.1
Source:, Recombinant protein corresponding to aa328-461 from human BEND3, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.5kD, AA Sequence: CLPQLNDFFSRFWAQREMEDSQPSGQVASFFEAEQVDPGHFLDNKDQEEALSLDRSSTIASDHVVDTQDLTEFLDEASSPGEFAVFLLHRLFPELFDHRKLGEQYSCYGDGGKQELDPQRLQIIRNYTEIYFPD, Storage and...
| Keywords: | BEND3, KIAA1553, BEN domain-containing protein 3 |
| MW: | 42,5 |
From 603.00€
*
Item number: ATA-APrEST72814.100
Protein function: Transcriptional repressor which associates with the NoRC (nucleolar remodeling complex) complex and plays a key role in repressing rDNA transcription. The sumoylated form modulates the stability of the NoRC complex component BAZ2A/TIP5 by controlling its USP21-mediated deubiquitination...
| Keywords: | BEND3, KIAA1553, BEN domain-containing protein 3 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: 372436.100
Source:, Recombinant protein corresponding to aa328-461 from human BEND3, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.5kD, AA Sequence: CLPQLNDFFSRFWAQREMEDSQPSGQVASFFEAEQVDPGHFLDNKDQEEALSLDRSSTIASDHVVDTQDLTEFLDEASSPGEFAVFLLHRLFPELFDHRKLGEQYSCYGDGGKQELDPQRLQIIRNYTEIYFPD, Storage and...
| Keywords: | BEND3, KIAA1553, BEN domain-containing protein 3 |
| MW: | 17,5 |
From 557.00€
*
Item number: CSB-CL729205HU.10
Length: 2487 Sequence: ATGAACTCAA CTGAATTCAC CGAAGATGTA GAAGAAGTTC TAAAAAGTAT CACTGTGAAA GTGGAGACAG AGGCTGAAGA TGCTGCTCTG GACTGCTCCG TGAATTCCAG GACTTCTGAG AAGCACTCTG TGGACAGCGT CCTCACTGCC CTGCAGGACT CCAGCAAACG AAAGCAGCTG GTCAGCGATG GCCTGCTAGA CTCTGTCCCC GGCGTGAAGA GGAGGCGGCT GATCCCCGAG GCTCTCCTAG CAGGCATGCG...
| Keywords: | BEND3, KIAA1553, BEN domain-containing protein 3 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
482.00€
*
Item number: ABS-PP-3154.100
Protein function: Transcriptional repressor which associates with the NoRC (nucleolar remodeling complex) complex and plays a key role in repressing rDNA transcription. The sumoylated form modulates the stability of the NoRC complex component BAZ2A/TIP5 by controlling its USP21-mediated deubiquitination...
| Keywords: | BEN domain-containing protein 3, Recombinant Human BEND3 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 14 kD |
From 90.00€
*
Item number: CSB-PA729205ZA01HU.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-BEND3, Anti-KIAA1553, Anti-BEN domain-containing protein 3, BEND3 Antibody |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Homo sapiens (Human) |
From 1,529.00€
*
Item number: ABS-PP-3154-L.100
Protein function: Transcriptional repressor which associates with the NoRC (nucleolar remodeling complex) complex and plays a key role in repressing rDNA transcription. The sumoylated form modulates the stability of the NoRC complex component BAZ2A/TIP5 by controlling its USP21-mediated deubiquitination...
| Keywords: | BEN domain-containing protein 3, Recombinant Human BEND3 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 14 kD |
From 115.00€
*