- Search results for Q5M9Q1
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
12 products were found matching "Q5M9Q1"!
Close filters
Filter by:
No results were found for the filter!
Item number: G-PACO63099.50
NKAPL Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, WB applications. NKAPL Antibody is a high quality polyclonal antibody for research use only.. Protein function: Transcriptional repressor of Notch-mediated signaling. Required for spermatogenesis. [The...
| Keywords: | Anti-NKAPL, Anti-C6orf194, Anti-NKAP-like protein |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
313.00€
*
Item number: ATA-HPA071697.100
Polyclonal Antibody against Human NKAPL, Gene description: NFKB activating protein like, Alternative Gene Names: bA424I5.1, C6orf194, Validated applications: ICC, Uniprot ID: Q5M9Q1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Transcriptional repressor...
| Keywords: | Anti-NKAPL, Anti-C6orf194, Anti-NKAP-like protein |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
NEW
Item number: ATA-HPA071697.25
Polyclonal Antibody against Human NKAPL, Gene description: NFKB activating protein like, Alternative Gene Names: bA424I5.1, C6orf194, Validated applications: ICC, Uniprot ID: Q5M9Q1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Transcriptional repressor...
| Keywords: | Anti-NKAPL, Anti-C6orf194, Anti-NKAP-like protein |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Item number: ABS-PP-12185-L.100
Protein function: Transcriptional repressor of Notch-mediated signaling. Required for spermatogenesis. [The UniProt Consortium]
| Keywords: | NKAP-like protein, Recombinant Human NKAPL Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 17.5 kD |
From 115.00€
*
Item number: 038986.200
The function of NKAPL remains unknown. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12...
| Keywords: | Anti-NKAPL, Anti-C6orf194, Anti-NKAP-like protein |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
Item number: CSB-CL702797HU.10
Length: 1209 Sequence: atgcccccag tatcccggtc cagctattcc gaggacatcg tgggctctcg gagaaggcga cgcagctcct cggggagccc accatccccg cagagcagat gttcctcttg ggatggctgt tcccgctctc actcccgcgg ccgtgagggc ctcaggcctc cttggagtga gttggacgtg ggcgctcttt acccctttag tcgctctggg tcgcgagggc ggctcccaag attccgcaac tacgccttcg cgtcctcctg...
| Keywords: | NKAPL, C6orf194, NKAP-like protein |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
450.00€
*
Item number: CSB-PA702797NB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: NKAPL. Antigen Species: Human
| Keywords: | Anti-NKAPL, Anti-C6orf194, Anti-NKAP-like protein, NKAPL antibody, C6orf194 antibody, NKAP-like protein antibody, NKAPL... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA702797ND01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: NKAPL. Antigen Species: Human
| Keywords: | Anti-NKAPL, Anti-C6orf194, Anti-NKAP-like protein, NKAPL antibody, C6orf194 antibody, NKAP-like protein antibody, NKAPL... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA702797NA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: NKAPL. Antigen Species: Human
| Keywords: | Anti-NKAPL, Anti-C6orf194, Anti-NKAP-like protein, NKAPL antibody, C6orf194 antibody, NKAP-like protein antibody, NKAPL... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA702797NC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: NKAPL. Antigen Species: Human
| Keywords: | Anti-NKAPL, Anti-C6orf194, Anti-NKAP-like protein, NKAPL antibody, C6orf194 antibody, NKAP-like protein antibody, NKAPL... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: ABS-PP-12185.100
Protein function: Transcriptional repressor of Notch-mediated signaling. Required for spermatogenesis. [The UniProt Consortium]
| Keywords: | NKAP-like protein, Recombinant Human NKAPL Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 17.5 kD |
From 90.00€
*
Item number: ATA-APrEST96066.100
PrEST Antigen NKAPL, Gene description: NFKB activating protein like, Alternative Gene Names: bA424I5.1, C6orf194, Antigen sequence: KDSEEDLSEATWMEQPNVADTMDLIGPEAPIIHTSQD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Transcriptional repressor of Notch-mediated signaling....
| Keywords: | NKAPL, C6orf194, NKAP-like protein |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*