11 products were found matching "Q5HYI8"!
No results were found for the filter!
Anti-RABL3
Item number: ARG59858.100
| Keywords: | Anti-RABL3, Anti-Rab-like protein 3 |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
707.00€
*
Anti-RABL3
Item number: ATA-HPA035150.100
Protein function: Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function. Not required for myeloid cell development. [The UniProt...
| Keywords: | Anti-RABL3, Anti-Rab-like protein 3 |
| Application: | ICC, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Anti-RABL3
Item number: ATA-HPA035151.100
Protein function: Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function. Not required for myeloid cell development. [The UniProt...
| Keywords: | Anti-RABL3, Anti-Rab-like protein 3 |
| Application: | IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Anti-RABL3
Item number: ATA-HPA069861.100
Polyclonal Antibody against Human RABL3, Gene description: RAB, member of RAS oncogene family like 3, Alternative Gene Names: MGC23920, Validated applications: ICC, Uniprot ID: Q5HYI8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Required for KRAS...
| Keywords: | Anti-RABL3, Anti-Rab-like protein 3 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
RABL3 (human), recombinant protein
Item number: ABS-PP-9200-L.100
Protein function: Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function. Not required for myeloid cell development. [The UniProt...
| Keywords: | Rab-like protein 3, Recombinant Human RABL3 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 18.5 kD |
From 115.00€
*
RABL3 PrEST Antigen
Item number: ATA-APrEST79393.100
Protein function: Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function. Not required for myeloid cell development. [The UniProt...
| Keywords: | RABL3, Rab-like protein 3 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
RABL3 PrEST Antigen
Item number: ATA-APrEST79394.100
Protein function: Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function. Not required for myeloid cell development. [The UniProt...
| Keywords: | RABL3, Rab-like protein 3 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Anti-RABL3
Item number: G-CAB14327.20
Protein function: Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function. Not required for myeloid cell development. [The UniProt...
| Keywords: | Anti-RABL3, Anti-Rab-like protein 3 |
| Application: | WB, IF |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
103.00€
*
Anti-RABL3
Item number: CSB-PA019239GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: RABL3. Antigen Species: Human
| Keywords: | Anti-RABL3, Anti-Rab-like protein 3, RAB member of RAS oncogene family like 3 antibody, Rab-like protein 3 antibody, RABL3... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
552.00€
*
RABL3 (human), recombinant protein
Item number: ABS-PP-9200.100
Protein function: Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function. Not required for myeloid cell development. [The UniProt...
| Keywords: | Rab-like protein 3, Recombinant Human RABL3 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 18.5 kD |
From 90.00€
*
RABL3 PrEST Antigen
Item number: ATA-APrEST95921.100
PrEST Antigen RABL3, Gene description: RAB, member of RAS oncogene family like 3, Alternative Gene Names: MGC23920, Antigen sequence: NKKSSQNLRRWSLEALNRDLVPTGVLVTNGDYDQEQFADNQIPLLVIGTKLDQIHETKRHEVLTRTAF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Required for KRAS...
| Keywords: | RABL3, Rab-like protein 3 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*