Protein function: May play a role in MAPK signaling. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 79% and to rat: 78%

Polyclonal Antibody against Human FAM83E, Gene description: family with sequence similarity 83 member E, Alternative Gene Names: FLJ20200, Validated applications: ICC, Uniprot ID: Q2M2I3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May play a role in...

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....

Protein function: May play a role in MAPK signaling. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.

PrEST Antigen FAM83E, Gene description: family with sequence similarity 83 member E, Alternative Gene Names: FLJ20200, Antigen sequence: DNELKKSWGSKDTPAKALMRQRGTGGGPWGEVDSRPPWGGALPLPPAHRLRYLSPARRRFGGDATFKLQEP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May play a role...