8 products were found matching "Q2M1K6"!

No results were found for the filter!
Zinc transporter ZIP13 (Slc39a13), partial, rat, recombinant
Zinc transporter ZIP13 (Slc39a13), partial, rat, recombinant

Item number: CSB-EP644804RA.1

Organism: Rattus norvegicus (Rat). Source: E.coli. Expression Region: 130-233aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-GST-tagged. Target Protein Sequence: WAYTCNISPG VEGQSLQRQQ QLGLWVIAGF LTFLALEKMF LNCKEEDPSQ APSKDPTAAA LNGGHCLAQP AAEPGLRAVV RNLKVSGYLN LLANTIDNFT HGLA. Purity: Greater than 90% as...
Keywords: Zip13, ZIP-13, Slc39a13, Zinc transporter ZIP13, Zrt- and Irt-like protein 13, Solute carrier family 39 member 13,...
Application: Activity not tested
Expressed in: E.coli
Origin: rat
MW: 41.2 kD
From 292.00€ *
Review
Slc39a13, Recombinant, Rat, aa130-233, His-GST-Tag (Zinc Transporter ZIP13)
Slc39a13, Recombinant, Rat, aa130-233, His-GST-Tag (Zinc...

Item number: 375323.100

Acts as a zinc-influx transporter. Source: Recombinant protein corresponding to aa130-233 from rat Slc39a13, fused to His-GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.2kD, AA Sequence: WAYTCNISPGVEGQSLQRQQQLGLWVIAGFLTFLALEKMFLNCKEEDPSQAPSKDPTAAALNGGHCLAQPAAEPGLRAVVRNLKVSGYLNLLANTIDNFTHGLA,...
Keywords: Zip13, ZIP-13, Slc39a13, Zinc transporter ZIP13, Zrt- and Irt-like protein 13, Solute carrier family 39 member 13
MW: 41,2
From 690.00€ *
Review
Slc39A13, Rat solute carrier family 39 (metal ion transporter), member 13, Real Time PCR Primer Set
Slc39A13, Rat solute carrier family 39 (metal ion...

Item number: VRPS-5756

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: Zip13, ZIP-13, Slc39a13, Zinc transporter ZIP13, Zrt- and Irt-like protein 13, Solute carrier family 39 member 13
Application: RNA quantification
54.00€ *
Review
Anti-Slc39a13
Anti-Slc39a13

Item number: G-PACO35854.50

Slc39a13 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Rat and for use in ELISA applications. Slc39a13 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Acts as a zinc-influx transporter. [The UniProt Consortium]
Keywords: Anti-Zip13, Anti-ZIP-13, Anti-Slc39a13, Anti-Zinc transporter ZIP13, Anti-Zrt- and Irt-like protein 13, Anti-Solute...
Application: ELISA
Host: Rabbit
Species reactivity: Rat
313.00€ *
Review
Anti-Slc39a13, HRP conjugated
Anti-Slc39a13, HRP conjugated

Item number: CSB-PA644804LB01RA.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Slc39a13. Antigen Species: Rattus norvegicus (Rat)
Keywords: Anti-Zip13, Anti-ZIP-13, Anti-Slc39a13, Anti-Zinc transporter ZIP13, Anti-Zrt- and Irt-like protein 13, Anti-Solute...
Application: ELISA
Host: Rabbit
Species reactivity: rat
From 167.00€ *
Review
Anti-Slc39a13
Anti-Slc39a13

Item number: CSB-PA644804LA01RA.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Slc39a13. Antigen Species: Rattus norvegicus (Rat)
Keywords: Anti-Zip13, Anti-ZIP-13, Anti-Slc39a13, Anti-Zinc transporter ZIP13, Anti-Zrt- and Irt-like protein 13, Anti-Solute...
Application: ELISA
Host: Rabbit
Species reactivity: rat
From 167.00€ *
Review
Anti-Slc39a13, FITC conjugated
Anti-Slc39a13, FITC conjugated

Item number: CSB-PA644804LC01RA.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Slc39a13. Antigen Species: Rattus norvegicus (Rat)
Keywords: Anti-Zip13, Anti-ZIP-13, Anti-Slc39a13, Anti-Zinc transporter ZIP13, Anti-Zrt- and Irt-like protein 13, Anti-Solute...
Host: Rabbit
Species reactivity: rat
From 167.00€ *
Review
Anti-Slc39a13, Biotin conjugated
Anti-Slc39a13, Biotin conjugated

Item number: CSB-PA644804LD01RA.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Slc39a13. Antigen Species: Rattus norvegicus (Rat)
Keywords: Anti-Zip13, Anti-ZIP-13, Anti-Slc39a13, Anti-Zinc transporter ZIP13, Anti-Zrt- and Irt-like protein 13, Anti-Solute...
Application: ELISA
Host: Rabbit
Species reactivity: rat
From 167.00€ *
Review