- Search results for Q2M1K6
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
8 products were found matching "Q2M1K6"!
Close filters
Filter by:
No results were found for the filter!
Item number: CSB-EP644804RA.1
Organism: Rattus norvegicus (Rat). Source: E.coli. Expression Region: 130-233aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-GST-tagged. Target Protein Sequence: WAYTCNISPG VEGQSLQRQQ QLGLWVIAGF LTFLALEKMF LNCKEEDPSQ APSKDPTAAA LNGGHCLAQP AAEPGLRAVV RNLKVSGYLN LLANTIDNFT HGLA. Purity: Greater than 90% as...
| Keywords: | Zip13, ZIP-13, Slc39a13, Zinc transporter ZIP13, Zrt- and Irt-like protein 13, Solute carrier family 39 member 13,... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | rat |
| MW: | 41.2 kD |
From 292.00€
*
Item number: 375323.100
Acts as a zinc-influx transporter. Source: Recombinant protein corresponding to aa130-233 from rat Slc39a13, fused to His-GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.2kD, AA Sequence: WAYTCNISPGVEGQSLQRQQQLGLWVIAGFLTFLALEKMFLNCKEEDPSQAPSKDPTAAALNGGHCLAQPAAEPGLRAVVRNLKVSGYLNLLANTIDNFTHGLA,...
| Keywords: | Zip13, ZIP-13, Slc39a13, Zinc transporter ZIP13, Zrt- and Irt-like protein 13, Solute carrier family 39 member 13 |
| MW: | 41,2 |
From 690.00€
*
Item number: VRPS-5756
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | Zip13, ZIP-13, Slc39a13, Zinc transporter ZIP13, Zrt- and Irt-like protein 13, Solute carrier family 39 member 13 |
| Application: | RNA quantification |
54.00€
*
Item number: G-PACO35854.50
Slc39a13 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Rat and for use in ELISA applications. Slc39a13 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Acts as a zinc-influx transporter. [The UniProt Consortium]
| Keywords: | Anti-Zip13, Anti-ZIP-13, Anti-Slc39a13, Anti-Zinc transporter ZIP13, Anti-Zrt- and Irt-like protein 13, Anti-Solute... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | Rat |
313.00€
*
Item number: CSB-PA644804LB01RA.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Slc39a13. Antigen Species: Rattus norvegicus (Rat)
| Keywords: | Anti-Zip13, Anti-ZIP-13, Anti-Slc39a13, Anti-Zinc transporter ZIP13, Anti-Zrt- and Irt-like protein 13, Anti-Solute... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | rat |
From 167.00€
*
Item number: CSB-PA644804LA01RA.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Slc39a13. Antigen Species: Rattus norvegicus (Rat)
| Keywords: | Anti-Zip13, Anti-ZIP-13, Anti-Slc39a13, Anti-Zinc transporter ZIP13, Anti-Zrt- and Irt-like protein 13, Anti-Solute... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | rat |
From 167.00€
*
Item number: CSB-PA644804LC01RA.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Slc39a13. Antigen Species: Rattus norvegicus (Rat)
| Keywords: | Anti-Zip13, Anti-ZIP-13, Anti-Slc39a13, Anti-Zinc transporter ZIP13, Anti-Zrt- and Irt-like protein 13, Anti-Solute... |
| Host: | Rabbit |
| Species reactivity: | rat |
From 167.00€
*
Item number: CSB-PA644804LD01RA.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Slc39a13. Antigen Species: Rattus norvegicus (Rat)
| Keywords: | Anti-Zip13, Anti-ZIP-13, Anti-Slc39a13, Anti-Zinc transporter ZIP13, Anti-Zrt- and Irt-like protein 13, Anti-Solute... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | rat |
From 167.00€
*