- Search results for Q29TV8
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
6 products were found matching "Q29TV8"!
Close filters
Filter by:
No results were found for the filter!
NEW
Item number: ELK-ELK6260MS.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat GKN2. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat GKN2. Next,...
| Keywords: | Gkn2, Blottin, Gastrokine-2 |
| Application: | ELISA |
| Species reactivity: | rat |
From 374.00€
*
Item number: ELK-ELK6260.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat GKN2. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat GKN2. Next,...
| Keywords: | Blot, Gkn2, Blottin, Gastrokine-2 |
| Application: | ELISA |
| Species reactivity: | rat |
From 374.00€
*
Item number: G-AEKE09661.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat GKN2. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat GKN2. Next,...
| Keywords: | Gkn2, Blottin, Gastrokine-2 |
| Application: | ELISA |
| Species reactivity: | human |
694.00€
*
Item number: G-AEKE09660.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat GKN2. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat GKN2. Next,...
| Keywords: | Gkn2, Blottin, Gastrokine-2 |
| Application: | ELISA |
| Species reactivity: | human |
694.00€
*
Item number: 154742.10
Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q29TV8, Fragment: Lys21~Leu184 (Accession No: Q29TV8), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-KEVFNIFVPG NNGGNVQETV TIDNQENTAT INIHSGSCSS TTIFDYKHGY IASRVLSRRA...
From 512.00€
*
Item number: G-RTFI00818.96
| Application: | ELISA |
| Species reactivity: | rat |
698.00€
*