6 products were found matching "Q29TV8"!
No results were found for the filter!
NEW
Rat GKN2 (Gastrokine 2) Microsample ELISA Kit
Item number: ELK-ELK6260MS.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat GKN2. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat GKN2. Next,...
| Keywords: | Gkn2, Blottin, Gastrokine-2 |
| Application: | ELISA |
| Species reactivity: | rat |
From 374.00€
*
Rat GKN2 (Gastrokine 2) ELISA Kit
Item number: ELK-ELK6260.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat GKN2. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat GKN2. Next,...
| Keywords: | Blot, Gkn2, Blottin, Gastrokine-2 |
| Application: | ELISA |
| Species reactivity: | rat |
From 374.00€
*
Rat GKN2 (Gastrokine 2) ELISA (Small Sample Volume)
Item number: G-AEKE09661.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat GKN2. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat GKN2. Next,...
| Keywords: | Gkn2, Blottin, Gastrokine-2 |
| Application: | ELISA |
| Species reactivity: | human |
694.00€
*
Rat GKN2 (Gastrokine 2) ELISA Kit
Item number: G-AEKE09660.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat GKN2. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat GKN2. Next,...
| Keywords: | Gkn2, Blottin, Gastrokine-2 |
| Application: | ELISA |
| Species reactivity: | human |
694.00€
*
Gastrokine 2 (GKN2) Recombinant, Rat
Item number: 154742.10
Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q29TV8, Fragment: Lys21~Leu184 (Accession No: Q29TV8), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-KEVFNIFVPG NNGGNVQETV TIDNQENTAT INIHSGSCSS TTIFDYKHGY IASRVLSRRA...
From 512.00€
*
Rat GKN2 / Gastrokine 2 ELISA Kit
Item number: G-RTFI00818.96
| Application: | ELISA |
| Species reactivity: | rat |
698.00€
*