- Search results for Q17RP2
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
10 products were found matching "Q17RP2"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA044599.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 36% and to rat: 36%
| Keywords: | Anti-TIGD6, Anti-Tigger transposable element-derived protein 6 |
| Application: | ICC, IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Item number: NSJ-RQ7502
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The protein encoded by this gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases....
| Keywords: | Anti-TIGD6, Anti-Tigger transposable element-derived protein 6, TIGD6 Antibody / Tigger transposable element-derived... |
| Application: | WB, FC, Direct ELISA |
| Host: | Rabbit |
| Species reactivity: | human, rat |
790.00€
*
Item number: ATA-HPA057538.100
Polyclonal Antibody against Human TIGD6, Gene description: tigger transposable element derived 6, Alternative Gene Names: DKFZp761E2110, Validated applications: ICC, Uniprot ID: Q17RP2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 35% Rat gene...
| Keywords: | Anti-TIGD6, Anti-Tigger transposable element-derived protein 6 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ABS-PP-2211-L.100
| Keywords: | Tigger transposable element-derived protein 6, Recombinant Human TIGD6 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 16 kD |
From 115.00€
*
Item number: VHPS-9276
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | TIGD6, Tigger transposable element-derived protein 6 |
| Application: | RNA quantification |
45.00€
*
Item number: ATA-APrEST80108.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | TIGD6, Tigger transposable element-derived protein 6 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ELK-ES19608.100
Recommended dilutions: WB 1:1000-2000. Cellular localization: Nucleus .
| Keywords: | Anti-TIGD6, Anti-Tigger transposable element-derived protein 6, TIGD6 rabbit pAb |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, rat, mouse, |
From 173.00€
*
Item number: CSB-CL615068HU.10
Length: 1566 Sequence: atggcaaaca aggggaacaa gaagcgtcgg cagttctctc tggaggagaa aatgaaagtt gtgggagctg tagactcagg caagaggaaa ggtgatgtgg caaaagaatt tggtatcact ccctctactt tatctacatt cttaaaggat cgcaccaaat ttgaagaaaa ggtgcgggag gcatccgtgg gaccccagcg gaaaaggatg aggagcgctc tttatgatga cattgataag gctgtttttg cttggtttca...
| Keywords: | TIGD6, Tigger transposable element-derived protein 6 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
576.00€
*
Item number: ABS-PP-2211.100
| Keywords: | Tigger transposable element-derived protein 6, Recombinant Human TIGD6 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 16 kD |
From 90.00€
*
Item number: ATA-APrEST96010.100
PrEST Antigen TIGD6, Gene description: tigger transposable element derived 6, Alternative Gene Names: DKFZp761E2110, Antigen sequence: MANKGNKKRRQFSLEEKMKVVGAVDSGKRKGDVAKEFGITPSTLSTFLKDRTKFEEKVREASVGPQRKRMRSALYDDIDKAVFAWFQEIHAK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene...
| Keywords: | TIGD6, Tigger transposable element-derived protein 6 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*