10 products were found matching "Q17RP2"!

No results were found for the filter!
Anti-TIGD6
Anti-TIGD6

Item number: ATA-HPA044599.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 36% and to rat: 36%
Keywords: Anti-TIGD6, Anti-Tigger transposable element-derived protein 6
Application: ICC, IHC, WB
Host: Rabbit
Species reactivity: human
From 369.00€ *
Review
Anti-TIGD6 / Tigger transposable element-derived protein 6
Anti-TIGD6 / Tigger transposable element-derived protein 6

Item number: NSJ-RQ7502

0.5mg/ml if reconstituted with 0.2ml sterile DI water. The protein encoded by this gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases....
Keywords: Anti-TIGD6, Anti-Tigger transposable element-derived protein 6, TIGD6 Antibody / Tigger transposable element-derived...
Application: WB, FC, Direct ELISA
Host: Rabbit
Species reactivity: human, rat
790.00€ *
Review
Anti-TIGD6
Anti-TIGD6

Item number: ATA-HPA057538.100

Polyclonal Antibody against Human TIGD6, Gene description: tigger transposable element derived 6, Alternative Gene Names: DKFZp761E2110, Validated applications: ICC, Uniprot ID: Q17RP2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 35% Rat gene...
Keywords: Anti-TIGD6, Anti-Tigger transposable element-derived protein 6
Application: ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
TIGD6 (human), recombinant protein
TIGD6 (human), recombinant protein

Item number: ABS-PP-2211-L.100

Keywords: Tigger transposable element-derived protein 6, Recombinant Human TIGD6 Protein
Expressed in: E.coli
Origin: human
MW: 16 kD
From 115.00€ *
Review
TIGD6, Human tigger transposable element derived 6, Real Time PCR Primer Set
TIGD6, Human tigger transposable element derived 6, Real...

Item number: VHPS-9276

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: TIGD6, Tigger transposable element-derived protein 6
Application: RNA quantification
45.00€ *
Review
TIGD6 PrEST Antigen
TIGD6 PrEST Antigen

Item number: ATA-APrEST80108.100

Buffer: PBS and 1M Urea, pH 7.4.
Keywords: TIGD6, Tigger transposable element-derived protein 6
Application: Control antigen
Expressed in: E.coli
Origin: human
264.00€ *
Review
Anti-TIGD6
Anti-TIGD6

Item number: ELK-ES19608.100

Recommended dilutions: WB 1:1000-2000. Cellular localization: Nucleus .
Keywords: Anti-TIGD6, Anti-Tigger transposable element-derived protein 6, TIGD6 rabbit pAb
Application: WB
Host: Rabbit
Species reactivity: human, rat, mouse,
From 173.00€ *
Review
TIGD6 (Vector pUC, Accession No. BC117249)
TIGD6 (Vector pUC, Accession No. BC117249)

Item number: CSB-CL615068HU.10

Length: 1566 Sequence: atggcaaaca aggggaacaa gaagcgtcgg cagttctctc tggaggagaa aatgaaagtt gtgggagctg tagactcagg caagaggaaa ggtgatgtgg caaaagaatt tggtatcact ccctctactt tatctacatt cttaaaggat cgcaccaaat ttgaagaaaa ggtgcgggag gcatccgtgg gaccccagcg gaaaaggatg aggagcgctc tttatgatga cattgataag gctgtttttg cttggtttca...
Keywords: TIGD6, Tigger transposable element-derived protein 6
Application: Molecular biology, clone
Species reactivity: human
576.00€ *
Review
TIGD6 (human), recombinant protein
TIGD6 (human), recombinant protein

Item number: ABS-PP-2211.100

Keywords: Tigger transposable element-derived protein 6, Recombinant Human TIGD6 Protein
Expressed in: E.coli
Origin: human
MW: 16 kD
From 90.00€ *
Review
TIGD6 PrEST Antigen
TIGD6 PrEST Antigen

Item number: ATA-APrEST96010.100

PrEST Antigen TIGD6, Gene description: tigger transposable element derived 6, Alternative Gene Names: DKFZp761E2110, Antigen sequence: MANKGNKKRRQFSLEEKMKVVGAVDSGKRKGDVAKEFGITPSTLSTFLKDRTKFEEKVREASVGPQRKRMRSALYDDIDKAVFAWFQEIHAK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene...
Keywords: TIGD6, Tigger transposable element-derived protein 6
Expressed in: E.coli
Origin: human
264.00€ *
Review