- Search results for Q15800
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
11 products were found matching "Q15800"!
Close filters
Filter by:
No results were found for the filter!
Item number: E-AB-16412.120
Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases. The protein is localized to the endoplasmic reticulum membrane and is believed to...
| Keywords: | Anti-DESP4, Anti-MSMO1, Anti-C-4 methylsterol oxidase, Anti-Methylsterol monooxygenase 1, MSMO1 Polyclonal Antibody |
| Application: | IHC, ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 89.00€
*
Item number: ATA-HPA056127.100
Protein function: Catalyzes the three-step monooxygenation required for the demethylation of 4,4-dimethyl and 4alpha-methylsterols, which can be subsequently metabolized to cholesterol (PubMed:21285510, PubMed:28673550, PubMed:23583456, PubMed:26114596). Also involved in drug metabolism, as it can metabolize...
| Keywords: | Anti-DESP4, Anti-MSMO1, Anti-C-4 methylsterol oxidase, Anti-Sterol-C4-methyl oxidase, Anti-Methylsterol monooxygenase 1 |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Item number: CSB-PA955910.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: MSMO1. Antigen Species: Human
| Keywords: | Anti-MSMO1, Anti-DESP4, Anti-Sterol-C4-methyl oxidase, Anti-C-4 methylsterol oxidase, Anti-Methylsterol monooxygenase 1,... |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA972591.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: MSMO1. Antigen Species: Human
| Keywords: | Anti-MSMO1, Anti-DESP4, Anti-Sterol-C4-methyl oxidase, Anti-C-4 methylsterol oxidase, Anti-Methylsterol monooxygenase 1,... |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: ATA-HPA055073.100
Polyclonal Antibody against Human MSMO1, Gene description: methylsterol monooxygenase 1, Alternative Gene Names: DESP4, ERG25, SC4MOL, Validated applications: ICC, Uniprot ID: Q15800, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Catalyzes the three-step...
| Keywords: | Anti-DESP4, Anti-MSMO1, Anti-C-4 methylsterol oxidase, Anti-Sterol-C4-methyl oxidase, Anti-Methylsterol monooxygenase 1 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ATA-HPA055073.25
Polyclonal Antibody against Human MSMO1, Gene description: methylsterol monooxygenase 1, Alternative Gene Names: DESP4, ERG25, SC4MOL, Validated applications: ICC, Uniprot ID: Q15800, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Catalyzes the three-step...
| Keywords: | Anti-DESP4, Anti-MSMO1, Anti-C-4 methylsterol oxidase, Anti-Sterol-C4-methyl oxidase, Anti-Methylsterol monooxygenase 1 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Item number: VHPS-8119
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | DESP4, SC4MOL, EC=1.14.13.72, C-4 methylsterol oxidase, Methylsterol monooxygenase |
| Application: | RNA quantification |
45.00€
*
Item number: 035202.200
Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases. The protein is localized to the endoplasmic reticulum membrane and is believed to...
| Keywords: | Anti-MSMO1, Anti-DESP4, EC=1.14.13.72, Anti-C-4 methylsterol oxidase, Anti-Methylsterol monooxygenase 1 |
| Application: | ELISA, IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
Item number: ATA-APrEST85272.100
Protein function: Catalyzes the three-step monooxygenation required for the demethylation of 4,4-dimethyl and 4alpha-methylsterols, which can be subsequently metabolized to cholesterol (PubMed:21285510, PubMed:28673550, PubMed:23583456, PubMed:26114596). Also involved in drug metabolism, as it can metabolize...
| Keywords: | DESP4, MSMO1, C-4 methylsterol oxidase, Sterol-C4-methyl oxidase, Methylsterol monooxygenase 1 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ELK-ES14699.100
Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases. The protein is localized to the endoplasmic reticulum membrane and is believed to...
| Keywords: | Anti-MSMO1, Anti-DESP4, Anti-C-4 methylsterol oxidase, Anti-Sterol-C4-methyl oxidase, Anti-Methylsterol monooxygenase 1,... |
| Application: | WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 173.00€
*
Item number: ATA-APrEST95657.100
PrEST Antigen MSMO1, Gene description: methylsterol monooxygenase 1, Alternative Gene Names: DESP4, ERG25, SC4MOL, Antigen sequence: VHSGYDIPLNPLNLIPFYAGSRHHDFHHMNFIGNYASTFTWWDRIFGTDSQYNA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Catalyzes the three-step...
| Keywords: | MSMO1, DESP4, C-4 methylsterol oxidase, Sterol-C4-methyl oxidase, Methylsterol monooxygenase 1 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*