- Search results for Q13867
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
18 products were found matching "Q13867"!
Close filters
Filter by:
No results were found for the filter!
Item number: ARG59580.100
Protein function: The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B- aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity. [The UniProt Consortium]
| Keywords: | Anti-BH, Anti-BMH, Anti-BLMH, EC=3.4.22.40, Anti-BLM hydrolase, Anti-Bleomycin hydrolase |
| Application: | ICC, IF, WB |
| Host: | Rabbit |
| Species reactivity: | human, rat |
707.00€
*
Item number: ARG59631.100
Protein function: The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B- aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity. [The UniProt Consortium]
| Keywords: | Anti-BH, Anti-BMH, Anti-BLMH, EC=3.4.22.40, Anti-BLM hydrolase, Anti-Bleomycin hydrolase |
| Application: | IHC (paraffin), WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
616.00€
*
Item number: ATA-HPA064307.100
Protein function: The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B- aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity. [The UniProt Consortium]...
| Keywords: | Anti-BH, Anti-BMH, Anti-BLMH, EC=3.4.22.40, Anti-BLM hydrolase, Anti-Bleomycin hydrolase |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Item number: ATA-HPA039548.100
Protein function: The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B- aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity. [The UniProt Consortium]...
| Keywords: | Anti-BH, Anti-BMH, Anti-BLMH, EC=3.4.22.40, Anti-BLM hydrolase, Anti-Bleomycin hydrolase |
| Application: | IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 246.00€
*
Item number: ELK-ELK3153.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human BLMH. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human BLMH. Next,...
| Keywords: | BH, BMH, BLMH, EC=3.4.22.40, BLM hydrolase, Bleomycin hydrolase |
| Application: | ELISA |
| Species reactivity: | human |
From 374.00€
*
Item number: B2105-61.100
BLMH is a member of the papain superfamily of the cysteine protease and the peptidase C1 family. It is a cytoplasmic cysteinepeptidase commonly found as a homohexamer. The normal physiological role of BLMH is unknown, but it protects normal and malignant cells from the glycopeptide antitumor drug BLM. It catalyzes...
| Keywords: | BH, BMH, BLMH, EC=3.4.22.40, BLM hydrolase, Bleomycin hydrolase |
| Origin: | human |
From 636.00€
*
Item number: CSB-EL002716HU.48
Sample Types: serum, plasma, tissue homogenates, cell lysates Detection Range: 28 pg/mL-1800 pg/mL Sensitivity: 7 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: The normal physiological role of BLM hydrolase is unknown,...
| Keywords: | BH, BMH, BLMH, EC=3.4.22.40, BLM hydrolase, Bleomycin hydrolase |
| Application: | ELISA, Sandwich ELISA |
| Species reactivity: | human |
From 581.00€
*
Item number: VHPS-837
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | BH, BMH, BLMH, EC=3.4.22.40, BLM hydrolase, Bleomycin hydrolase |
| Application: | RNA quantification |
45.00€
*
Item number: B2105-60M.10
Bleomycin Hydrolase (BLMH) is a cysteine peptidase of the papain superfamily. It is named for its ability to hydrolyze the antitumor agent bleomycin and inactivate it. It has a papainlike catalytic triad (CysHisAsp) with optimum activity at neutral pH. In mammals it is expressed ubiquitously in all types of...
| Keywords: | EC=3.4.22.40, BLM hydrolase, Bleomycin hydrolase |
| MW: | 53 kD |
1,096.00€
*
Item number: 153685.10
Source:, Recombinant Human from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q13867, Fragment: Met213~Trp447 (Accession No: Q13867), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGS-MEEIFRVV CICLGNPPET FTWEYRDKDK NYQKIGPITP LEFYREHVKP LFNMEDKICL...
From 454.00€
*
Item number: NSJ-F54739-0.08ML
In 1X PBS, pH 7.4, with 0.09% sodium azide. The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B-aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity (By...
| Keywords: | Anti-BH, Anti-BMH, Anti-BLMH, EC=3.4.22.40, Anti-BLM hydrolase, Anti-Bleomycin hydrolase, Bleomycin hydrolase Antibody / BLMH |
| Application: | IHC (paraffin), WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 361.00€
*
Item number: ATA-APrEST75558.100
Protein function: The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B- aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity. [The UniProt Consortium]...
| Keywords: | BH, BMH, BLMH, EC=3.4.22.40, BLM hydrolase, Bleomycin hydrolase |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*