5 products were found matching "P9WNK2"!
No results were found for the filter!
ESAT-6-like protein EsxH (esxH), partial, Mycobacterium...
Item number: CSB-EP363659MVZ.1
Organism: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh). Source: E.coli. Expression Region: 2-96aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: SQIMYNYPAM LGHAGDMAGY AGTLQSLGAE IAVEQAALQS AWQGDTGITY QAWQAQWNQA MEDLVRAYHA MSSTHEANTM AMMARDTAEA AKWGG. Purity:...
| Keywords: | cfp7, CFP-7, MT0301, Protein TB10.4, 10 kDa antigen CFP7, ESAT-6-like protein EsxH, Low molecular weight protein antigen... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | Mycobacterium tuberculosis |
| MW: | 26.3 kD |
From 364.00€
*
EsxH Protein, Mycobacterium tuberculosis, Recombinant...
Item number: TGM-TMPH-03011-100ug
Description: EsxH, in complex with EsxG, disrupts ESCRT function and impairs host phagosome maturation, thereby promoting intracellular bacterial growth. The complex acts by interacting, via EsxH, with the host hepatocyte growth factor-regulated tyrosine kinase substrate (HGS/HRS), a component of the ESCRT machinery.
| Keywords: | Low molecular weight protein antigen 7, esxH, ESAT-6-like protein EsxH, Protein TB10.4, 10 kDa antigen CFP7 |
| MW: | 26.3 kD |
From 340.00€
*
EsxH Protein, Mycobacterium tuberculosis, Recombinant...
Item number: TGM-TMPH-03011-10ug
Description: EsxH, in complex with EsxG, disrupts ESCRT function and impairs host phagosome maturation, thereby promoting intracellular bacterial growth. The complex acts by interacting, via EsxH, with the host hepatocyte growth factor-regulated tyrosine kinase substrate (HGS/HRS), a component of the ESCRT machinery.
| Keywords: | esxH , Protein TB10.4 , ESAT-6-like protein EsxH , cfp7 , 10 kDa antigen CFP7 (CFP-7) , Low molecular weight protein... |
| MW: | 26.3 kD |
From 122.00€
*
ESAT-6-like Protein EsxH, Recombinant, Mycobacterium...
Item number: 370605.100
Source:, Recombinant protein corresponding to aa2-96 from Mycobacterium tuberculosis esxH, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~26.25kD, AA Sequence: SQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG, Storage and Stability: May...
| Keywords: | cfp7, CFP-7, MT0301, Protein TB10.4, 10 kDa antigen CFP7, ESAT-6-like protein EsxH, Low molecular weight protein antigen 7 |
| MW: | 26,25 |
From 786.00€
*
Anti-esxH
Item number: CSB-PA363659ZA01MVZ.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-cfp7, Anti-CFP-7, Anti-MT0301, Anti-Protein TB10.4, Anti-10 kDa antigen CFP7, Anti-ESAT-6-like protein EsxH, Anti-Low... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
From 1,529.00€
*
