7 products were found matching "P98198"!
No results were found for the filter!
Anti-ATP8B2
Item number: ATA-HPA061103.100
Polyclonal Antibody against Human ATP8B2, Gene description: ATPase phospholipid transporting 8B2, Alternative Gene Names: ATPID, KIAA1137, Validated applications: ICC, Uniprot ID: P98198, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Catalytic component...
| Keywords: | Anti-ATPID, Anti-ATP8B2, EC=7.6.2.1, Anti-ATPase class I type 8B member 2, Anti-Phospholipid-transporting ATPase ID,... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
477.00€
*
Anti-ATP8B2
Item number: ATA-HPA046680.100
Protein function: Catalytic component of a P4-ATPase flippase complex which catalyzes the hydrolysis of ATP coupled to the transport of aminophospholipids from the outer to the inner leaflet of various membranes and ensures the maintenance of asymmetric distribution of phospholipids. Phospholipid translocation seems...
| Keywords: | Anti-ATPID, Anti-ATP8B2, EC=7.6.2.1, Anti-ATPase class I type 8B member 2, Anti-Phospholipid-transporting ATPase ID,... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 358.00€
*
ATP8B2 (human), recombinant protein
Item number: ABS-PP-2123.100
| Keywords: | Phospholipid-transporting ATPase ID, ATPase class I type 8B member 2, P4-ATPase flippase complex alpha subunit ATP8B2,... |
| MW: | 21 kD |
From 90.00€
*
ATP8B2 PrEST Antigen
Item number: ATA-APrEST95593.100
PrEST Antigen ATP8B2, Gene description: ATPase phospholipid transporting 8B2, Alternative Gene Names: ATPID, KIAA1137, Antigen sequence: AREKMMDSSRSVGNGFTYQDKLSSSKLTSVLEAVAG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Catalytic component of a P4-ATPase flippase...
| Keywords: | ATPID, ATP8B2, EC=7.6.2.1, ATPase class I type 8B member 2, Phospholipid-transporting ATPase ID, P4-ATPase flippase... |
| Expressed in: | E.coli |
| Origin: | human |
265.00€
*
Anti-AT8B2, NT (ATP8B2, ATPID, KIAA1137, Probable...
Item number: 032152.200
The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. Alternatively spliced...
| Keywords: | Anti-ATPID, Anti-ATP8B2, EC=3.6.3.1, Anti-ATPase class I type 8B member 2, Anti-Probable phospholipid-transporting ATPase ID |
| Application: | ELISA, FC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
767.00€
*
ATP8B2 PrEST Antigen
Item number: ATA-APrEST78529.100
Protein function: Catalytic component of a P4-ATPase flippase complex which catalyzes the hydrolysis of ATP coupled to the transport of aminophospholipids from the outer to the inner leaflet of various membranes and ensures the maintenance of asymmetric distribution of phospholipids. Phospholipid translocation seems...
| Keywords: | ATPID, ATP8B2, EC=7.6.2.1, ATPase class I type 8B member 2, Phospholipid-transporting ATPase ID, P4-ATPase flippase... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
265.00€
*
Anti-AT8B2
Item number: ELK-ES19212.100
Protein function: Catalytic component of P4-ATPase flippase complex, which catalyzes the hydrolysis of ATP coupled to the transport of phosphatidylcholine (PC) from the outer to the inner leaflet of the plasma membrane. May contribute to the maintenance of membrane lipid asymmetry. [The UniProt Consortium]...
| Keywords: | Anti-ATPID, Anti-ATPase class I type 8B member 2, Anti-Phospholipid-transporting ATPase ID, Anti-P4-ATPase flippase... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 173.00€
*