6 products were found matching "P82019"!

No results were found for the filter!
Mouse Beta-defensin 4 / Defb4 ELISA Kit
Mouse Beta-defensin 4 / Defb4 ELISA Kit

Item number: G-MOFI00220.96

Application: ELISA
Species reactivity: mouse
698.00€ *
Review
Beta-defensin 4 (Defb4), mouse, recombinant
Beta-defensin 4 (Defb4), mouse, recombinant

Item number: CSB-EP305482MO.1

Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 23-63aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: QIINNPITCM TNGAICWGPC PTAFRQIGNC GHFKVRCCKI R. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin: Not test....
Keywords: BD-4, Bdef4, Defb4, mBD-4, Beta-defensin 4, Defensin, beta 4, Recombinant Mouse Beta-defensin 4 (Defb4)
Application: Activity not tested
Expressed in: E.coli
Origin: mouse
MW: 20.6 kD
From 292.00€ *
Review
DEFB4 Protein, Mouse, Recombinant (His & SUMO)
DEFB4 Protein, Mouse, Recombinant (His & SUMO)

Item number: TGM-TMPH-02544-100ug

Description: Exhibits antimicrobial activity against Gram-negative bacteria and Gram-positive bacteria. May act as a ligand for C-C chemokine receptor CCR6. Can bind to mouse (but not human) CCR6 and induce chemotactic activity of CCR6-expressing cells. DEFB4 Protein, Mouse, Recombinant (His & SUMO) is expressed in...
Keywords: mBD-4, Defb4, Defensin, beta 4, Bdef4, BD-4, Beta-defensin 4
MW: 20.6 kD
From 266.00€ *
Review
NEW
DEFB4 Protein, Mouse, Recombinant (His & SUMO)
DEFB4 Protein, Mouse, Recombinant (His & SUMO)

Item number: TGM-TMPH-02544-10ug

Description: Exhibits antimicrobial activity against Gram-negative bacteria and Gram-positive bacteria. May act as a ligand for C-C chemokine receptor CCR6. Can bind to mouse (but not human) CCR6 and induce chemotactic activity of CCR6-expressing cells. DEFB4 Protein, Mouse, Recombinant (His & SUMO) is expressed in...
Keywords: Defb4 , Defensin, beta 4 , BD-4 , Beta-defensin 4 , Bdef4 , mBD-4
MW: 20.6 kD
From 99.00€ *
Review
Defb4, Recombinant, Mouse, aa23-63, His-SUMO-Tag (Beta-defensin 4)
Defb4, Recombinant, Mouse, aa23-63, His-SUMO-Tag...

Item number: 373031.100

Has bactericidal activity. Source: Recombinant protein corresponding to aa23-63 from mouse Defb4, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~20.6kD, AA Sequence: QIINNPITCMTNGAICWGPCPTAFRQIGNCGHFKVRCCKIR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to...
Keywords: BD-4, Bdef4, mBD-4, Defb4, Beta-defensin 4, Defensin, beta 4
MW: 20,6
From 690.00€ *
Review
Anti-Defb4
Anti-Defb4

Item number: CSB-PA305482ZA01MO.100

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
Keywords: Anti-BD-4, Anti-Defb4, Anti-mBD-4, Anti-Bdef4, Anti-Beta-defensin 4, Anti-Defensin, beta 4, Defb4 Antibody
Application: ELISA, WB
Host: Rabbit
Species reactivity: Mus musculus (Mouse)
From 1,529.00€ *
Review